Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
R01 Count 1
Funding $148,500
PubMed Score 6.33
PubTator Score 6.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 2.102 0.020
posterior fossa group A ependymoma 1.800 0.000
adrenocortical carcinoma 1.660 0.050
cystic fibrosis 3.100 0.001
subependymal giant cell astrocytoma 3.312 0.029
Alzheimer's disease 1.100 0.040
Pick disease 1.800 0.009
progressive supranuclear palsy 1.100 0.007
invasive ductal carcinoma -1.200 0.002
pituitary cancer 3.600 0.000

Gene RIF (3)

PMID Text
19491193 Promoter methylation and differential gene expression of five markers: COL1A2, NPM2, HSPB6, DDIT4L and MT1G were validated by sequencing of bisulfite-modified DNA and real-time reverse transcriptase PCR, respectively.
19268525 mediates monocyte cell death through a reduction in thioredoxin-1 expression
15632201 RTP801 and RTP801L work downstream of AKT and upstream of TSC2 to inhibit mTOR functions

AA Sequence

MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQ      1 - 70
TKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVF     71 - 140
KQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS                     141 - 193
//

Text Mined References (15)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
19491193 2009 Genome-wide screen of promoter methylation identifies novel markers in melanoma.
19268525 2009 The regulated in development and DNA damage response 2 (REDD2) gene mediates human monocyte cell death through a reduction in thioredoxin-1 expression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15632201 2005 The stress-inducted proteins RTP801 and RTP801L are negative regulators of the mammalian target of rapamycin pathway.
15545625 2004 Regulation of mTOR function in response to hypoxia by REDD1 and the TSC1/TSC2 tumor suppressor complex.
More...