Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.13
PubTator Score 0.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.102 7.5e-07
aldosterone-producing adenoma -1.480 4.8e-02
astrocytic glioma 1.400 7.4e-03
Breast cancer 2.200 3.7e-02
ependymoma 1.100 2.8e-02
glioblastoma 1.600 4.4e-03
medulloblastoma, large-cell 1.100 2.1e-03
oligodendroglioma 1.700 6.8e-03
osteosarcoma 1.568 2.2e-03
pediatric high grade glioma 1.400 1.1e-03

AA Sequence

MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLPRALGSGFPHL      1 - 70
QLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCRSLQVLNLSGNCFQEVPASLL     71 - 140
ELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKEIPPELGNLPSLNYLVLCDNKIQSIPPQLSQ    141 - 210
LHSLRSLSLHNNLLTYLPREILNLIHLEELSLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPY    211 - 280
DLPGNLLRYLGSASNCPNPKCGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQS    281 - 350
ESDSEDEASVAARRMQKVLLG                                                     351 - 371
//

Text Mined References (9)

PMID Year Title