Property Summary

NCBI Gene PubMed Count 8
PubMed Score 35.12
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 4.4e-07
group 4 medulloblastoma 1855 2.3e-06
osteosarcoma 7950 1.5e-05
pediatric high grade glioma 1064 2.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Enamel erosion 19 3.076 1.5
Cancer 2499 3.014 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.100 4.4e-07
group 4 medulloblastoma 1.300 2.3e-06
osteosarcoma 1.731 1.5e-05
pediatric high grade glioma 1.300 2.2e-05

AA Sequence

MNSSQISLRMKHGRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSECGSCFRKQSNLTQHLR      1 - 70
IHTGEKPYKCNECEKAFQTKAILVQHLRIHTGEKPYKCNECGKAFCQSPSLIKHQRIHTGEKPYKCTECG     71 - 140
KAFSQSICLTRHQRSHSGDKPFKCNECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVEHER    141 - 210
THTGEKLYKCSECEKTFRKQAHLSEHYRIHTGEKPYECVGCGKSFRHSSALLRHQRLHAGE             211 - 271
//

Text Mined References (8)

PMID Year Title