Property Summary

NCBI Gene PubMed Count 23
PubMed Score 26.16
PubTator Score 21.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (35)

Disease log2 FC p
sarcoidosis 1.100 3.6e-03
acute quadriplegic myopathy 1.213 4.1e-02
adrenocortical carcinoma -1.061 4.6e-02
aldosterone-producing adenoma -1.301 4.9e-02
Amyotrophic lateral sclerosis 1.394 2.7e-03
astrocytoma 1.500 2.1e-02
Breast cancer -1.600 5.0e-08
breast carcinoma -1.200 1.3e-26
chronic kidney disease 1.200 4.8e-02
chronic lymphosyte leukemia -2.100 2.5e-11
colon cancer -2.500 4.3e-02
cystic fibrosis 1.082 6.3e-05
cystic fibrosis and chronic rhinosinusit... -1.182 2.1e-02
Down syndrome 1.300 9.2e-04
Duchenne muscular dystrophy 2.172 1.2e-05
ductal carcinoma in situ -1.100 3.0e-03
glioblastoma 1.300 8.7e-03
group 4 medulloblastoma 1.600 1.8e-04
intraductal papillary-mucinous adenoma (... -2.500 1.1e-03
invasive ductal carcinoma -1.500 7.7e-03
juvenile dermatomyositis 1.149 6.9e-07
limb girdle muscular dystrophy 2A 1.060 4.2e-02
lung adenocarcinoma -1.500 1.3e-12
lung cancer -2.500 2.7e-05
malignant mesothelioma -1.400 4.0e-06
non primary Sjogren syndrome sicca 1.100 3.6e-02
non-small cell lung cancer -1.532 1.3e-15
osteosarcoma 1.684 4.9e-04
ovarian cancer -1.600 1.8e-02
pancreatic cancer 1.200 5.8e-03
Pick disease 1.400 8.4e-05
primary pancreatic ductal adenocarcinoma 1.305 4.2e-03
Rheumatoid arthritis 1.400 1.4e-02
tuberculosis 1.600 4.9e-05
ulcerative colitis -1.109 1.4e-02

Synonym

Accession Q96CX2
Symbols PFET1
PFETIN
C13orf2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (11)

AA Sequence

MALADSTRGLPNGGGGGGGSGSSSSSAEPPLFPDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQ      1 - 70
ELARDSKGRFFLDRDGFLFRYILDYLRDLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPP     71 - 140
PSRRGVHKEGSLGDELLPLGYSEPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYI    141 - 210
TIGYRGSYTIGRDAQADAKFRRVARITVCGKTSLAKEVFGDTLNESRDPDRPPERYTSRYYLKFNFLEQA    211 - 280
FDKLSESGFHMVACSSTGTCAFASSTDQSEDKIWTSYTEYVFCRE                             281 - 325
//

Text Mined References (33)

PMID Year Title