Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.90
PubTator Score 8.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.148 3.1e-02
Amyotrophic lateral sclerosis 1.129 2.5e-06
atypical teratoid / rhabdoid tumor 1.100 1.2e-03
group 4 medulloblastoma 1.500 1.2e-04
malignant mesothelioma 1.300 1.5e-06
medulloblastoma, large-cell 1.600 4.6e-05
oligodendroglioma 1.200 8.0e-03
osteosarcoma -2.093 1.7e-05
ovarian cancer -2.000 2.4e-06
psoriasis -1.100 2.4e-02
tuberculosis and treatment for 6 months 1.200 1.0e-03

Gene RIF (6)

AA Sequence

MATPDQKSPNVLLQNLCCRILGRSEADVAQQFQYAVRVIGSNFAPTVERDEFLVAEKIKKELIRQRREAD      1 - 70
AALFSELHRKLHSQGVLKNKWSILYLLLSLSEDPRRQPSKVSSYATLFAQALPRDAHSTPYYYARPQTLP     71 - 140
LSYQDRSAQSAQSSGSVGSSGISSIGLCALSGPAPAPQSLLPGQSNQAPGVGDCLRQQLGSRLAWTLTAN    141 - 210
QPSSQATTSKGVPSAVSRNMTRSRREGDTGGTMEITEAALVRDILYVFQGIDGKNIKMNNTENCYKVEGK    211 - 280
ANLSRSLRDTAVRLSELGWLHNKIRRYTDQRSLDRSFGLVGQSFCAALHQELREYYRLLSVLHSQLQLED    281 - 350
DQGVNLGLESSLTLRRLLVWTYDPKIRLKTLAALVDHCQGRKGGELASAVHAYTKTGDPYMRSLVQHILS    351 - 420
LVSHPVLSFLYRWIYDGELEDTYHEFFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRKVLLIGKSI    421 - 490
NFLHQVCHDQTPTTKMIAVTKSAESPQDAADLFTDLENAFQGKIDAAYFETSKYLLDVLNKKYSLLDHMQ    491 - 560
AMRRYLLLGQGDFIRHLMDLLKPELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLEVSP    561 - 630
GDTGWDVFSLDYHVDGPIATVFTRECMSHYLRVFNFLWRAKRMEYILTDIRKGHMCNAKLLRNMPEFSGV    631 - 700
LHQCHILASEMVHFIHQMQYYITFEVLECSWDELWNKVQQAQDLDHIIAAHEVFLDTIISRCLLDSDSRA    701 - 770
LLNQLRAVFDQIIELQNAQDAIYRAALEELQRRLQFEEKKKQREIEGQWGVTAAEEEEENKRIGEFKESI    771 - 840
PKMCSQLRILTHFYQGIVQQFLVLLTTSSDESLRFLSFRLDFNEHYKAREPRLRVSLGTRGRRSSHT       841 - 907
//

Text Mined References (28)

PMID Year Title