Property Summary

NCBI Gene PubMed Count 71
Grant Count 9
R01 Count 5
Funding $350,347.35
PubMed Score 389.91
PubTator Score 36.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.005
Multiple myeloma 1.777 0.000
psoriasis 1.500 0.000
ovarian cancer 3.400 0.000

Gene RIF (56)

PMID Text
26423947 HIV-1 Nef interacts weakly and directly with AP2M1 (AP-2mu) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
25048004 This study identified and confirmed adaptor protein 2 changes within the postsynaptic density in schizophrenia.
24843023 HIV-1 Nef interacts weakly and directly with AP2M1 (AP-2mu) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
24040105 BMCC1 is an AP-2 associated endosomal protein in prostate cancer cells.
23891661 We identify dynamin and the EAP-binding alpha-adaptin appendage domain of the AP2 adaptor as switches in a regulated, multistep maturation process and provide direct evidence for a molecular checkpoint in clathrin mediated endocytosis.
23125841 HIV-1 Nef interacts weakly and directly with AP2M1 (AP-2mu) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
23125841 HIV-1 Nef interacts weakly and directly with AP2M1 (AP-2mu) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
23125841 HIV-1 Nef interacts weakly and directly with AP2M1 (AP-2mu) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
23125841 HIV-1 Nef interacts weakly and directly with AP2M1 (AP-2mu) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
23077317 HIV-1 Nef interacts weakly and directly with AP2M1 (AP-2mu) in 293T cells and this interaction is dependent on Nef membrane localization as shown by FACS-Forster resonance energy transfer (FRET)-based and site-directed mutagenesis experiments
More...

AA Sequence

MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTK      1 - 70
QNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKS     71 - 140
QHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMP    141 - 210
ECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT    211 - 280
KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENA    281 - 350
IVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK    351 - 420
WVRYIGRSGIYETRC                                                           421 - 435
//

Text Mined References (84)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25048004 2015 Proteomic and genomic evidence implicates the postsynaptic density in schizophrenia.
24603492 2014 TBC1D5 and the AP2 complex regulate ATG9 trafficking and initiation of autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
24040105 2013 BMCC1 is an AP-2 associated endosomal protein in prostate cancer cells.
23891661 2013 Advances in analysis of low signal-to-noise images link dynamin and AP2 to the functions of an endocytic checkpoint.
23529131 2013 Oestrogen promotes KCNQ1 potassium channel endocytosis and postendocytic trafficking in colonic epithelium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916011 2012 Identification and targeting of an interaction between a tyrosine motif within hepatitis C virus core protein and AP2M1 essential for viral assembly.
More...