Property Summary

NCBI Gene PubMed Count 73
PubMed Score 397.14
PubTator Score 36.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.3e-04
ovarian cancer 8520 3.4e-04
Multiple myeloma 1332 3.4e-04
Rheumatoid arthritis 1191 4.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.777 3.4e-04
ovarian cancer -1.400 3.4e-04
psoriasis 1.500 3.3e-04
Rheumatoid arthritis -1.300 4.6e-03

Gene RIF (50)

AA Sequence

MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTK      1 - 70
QNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLIYELLDEILDFGYPQNSETGALKTFITQQGIKS     71 - 140
QHQTKEEQSQITSQVTGQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMP    141 - 210
ECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTFHQCVRLSKFDSERSISFIPPDGEFELMRYRTT    211 - 280
KDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENA    281 - 350
IVWKIKRMAGMKESQISAEIELLPTNDKKKWARPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIK    351 - 420
WVRYIGRSGIYETRC                                                           421 - 435
//

Text Mined References (86)

PMID Year Title