Property Summary

NCBI Gene PubMed Count 171
PubMed Score 1590.61
PubTator Score 401.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Paget's disease of bone 36 4.067 2.0
Disease Target Count Z-score Confidence
Glaucoma 239 7.356 3.7
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.700 2.7e-02
acute quadriplegic myopathy -1.051 2.3e-04
adult high grade glioma -1.800 1.4e-04
astrocytic glioma -1.100 1.8e-02
atypical teratoid / rhabdoid tumor -1.400 6.8e-06
colon cancer -1.500 1.2e-02
ductal carcinoma in situ -1.300 2.6e-03
ependymoma -2.100 6.6e-03
glioblastoma -1.700 3.7e-07
group 3 medulloblastoma -1.700 5.8e-04
lung cancer -1.300 1.2e-02
malignant mesothelioma -2.600 1.9e-07
medulloblastoma, large-cell -3.500 1.6e-06
non-small cell lung cancer -1.050 9.9e-10
oligodendroglioma -1.700 3.1e-02
osteosarcoma -1.470 4.1e-02
ovarian cancer -1.900 1.3e-05
primitive neuroectodermal tumor -1.100 6.0e-04
psoriasis -1.100 8.0e-06
spina bifida -1.624 4.0e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (146)

AA Sequence

MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFE      1 - 70
ELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEK     71 - 140
DQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTA    141 - 210
LSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEG    211 - 280
STEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSKAELMKKRLQEKCQALERKNSAIPSELNE    281 - 350
KQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDR    351 - 420
AVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKE    421 - 490
QLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGE    491 - 560
VLPDIDTLQIHVMDCII                                                         561 - 577
//

Text Mined References (182)

PMID Year Title