Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.87
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Rheumatoid Arthritis 1,160

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid Arthritis -1.400 0.007

Synonym

Accession Q96CT7
Symbols

Gene

Gene RIF (1)

PMID Text
23894443 Ccdc124 is a novel factor operating both for proper progression of late cytokinetic stages in eukaryotes.

AA Sequence

MPKKFQGENTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKET      1 - 70
QRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLREAPDTAEKAKSHLEVPLEENVNRRVLEEG     71 - 140
SVEARTIEDAIAVLSVAEEAADRHPERRMRAAFTAFEEAQLPRLKQENPNMRLSQLKQLLKKEWLRSPDN    141 - 210
PMNQRAVPFNAPK                                                             211 - 223
//

Text Mined References (9)

PMID Year Title
23894443 2013 Coiled-coil domain containing protein 124 is a novel centrosome and midbody protein that interacts with the Ras-guanine nucleotide exchange factor 1B and is involved in cytokinesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.