Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.87
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Rheumatoid arthritis 1191 7.2e-03

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid arthritis -1.400 7.2e-03

Gene RIF (1)

AA Sequence

MPKKFQGENTKSAAARARRAEAKAAADAKKQKELEDAYWKDDDKHVMRKEQRKEEKEKRRLDQLERKKET      1 - 70
QRLLEEEDSKLKGGKAPRVATSSKVTRAQIEDTLRRDHQLREAPDTAEKAKSHLEVPLEENVNRRVLEEG     71 - 140
SVEARTIEDAIAVLSVAEEAADRHPERRMRAAFTAFEEAQLPRLKQENPNMRLSQLKQLLKKEWLRSPDN    141 - 210
PMNQRAVPFNAPK                                                             211 - 223
//

Text Mined References (9)

PMID Year Title