Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.85
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (2)

PMID Text
22281740 The crystal structure at 1.75 A resolution of an apo form of human evectin-2 pleckstrin homology domain, in which the ligand-binding site is free from crystal packing and is thus appropriate for comparison with the structure of the complex, is reported.
21911378 Data show that depletion of evt-2 or masking of intracellular PS suppressed membrane traffic from REs to the Golgi.

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDG      1 - 70
KSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAP     71 - 140
EQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAA    141 - 210
TGMALGSLFWVF                                                              211 - 222
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22281740 2012 Structural basis of the strict phospholipid binding specificity of the pleckstrin homology domain of human evectin-2.
21911378 2011 Intracellular phosphatidylserine is essential for retrograde membrane traffic through endosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...