Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.85
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.0704986782566E-10
atypical teratoid / rhabdoid tumor 4369 1.31763161463799E-7
ovarian cancer 8492 6.72580579975435E-7
glioblastoma 5572 1.36827285468491E-6
medulloblastoma, large-cell 6234 2.07298882134313E-6
medulloblastoma 1524 3.821864351623E-5
psoriasis 6685 2.01057687822762E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00640859918708482
Multiple myeloma 1328 0.00679972502816451
dermatomyositis 967 0.00704272470312019
Bipolar Disorder 266 0.0330912266877624
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0344474895160405
Disease Target Count Z-score Confidence
Stuttering 18 3.822 1.9
Exudative vitreoretinopathy 15 3.507 1.8

Expression

  Differential Expression (12)

Gene RIF (2)

PMID Text
22281740 The crystal structure at 1.75 A resolution of an apo form of human evectin-2 pleckstrin homology domain, in which the ligand-binding site is free from crystal packing and is thus appropriate for comparison with the structure of the complex, is reported.
21911378 Data show that depletion of evt-2 or masking of intracellular PS suppressed membrane traffic from REs to the Golgi.

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDG      1 - 70
KSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAP     71 - 140
EQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAA    141 - 210
TGMALGSLFWVF                                                              211 - 222
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22281740 2012 Structural basis of the strict phospholipid binding specificity of the pleckstrin homology domain of human evectin-2.
21911378 2011 Intracellular phosphatidylserine is essential for retrograde membrane traffic through endosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...