Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.89
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 1.3e-07
Bipolar Disorder -1.200 3.3e-02
dermatomyositis 1.100 7.0e-03
ependymoma -1.300 4.6e-12
glioblastoma -1.100 1.4e-06
group 3 medulloblastoma -1.100 8.2e-04
intraductal papillary-mucinous carcinoma... 1.200 3.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 6.4e-03
medulloblastoma, large-cell -2.100 2.1e-06
Multiple myeloma 1.341 6.8e-03
ovarian cancer 2.700 6.7e-07
psoriasis -1.400 2.0e-04

Gene RIF (2)

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDG      1 - 70
KSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAP     71 - 140
EQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAA    141 - 210
TGMALGSLFWVF                                                              211 - 222
//

Text Mined References (16)

PMID Year Title