Property Summary

NCBI Gene PubMed Count 20
PubMed Score 28.87
PubTator Score 12.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 5.6e-07
Pick disease 1894 2.5e-05
ovarian cancer 8520 8.3e-05
osteosarcoma 7950 2.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Enophthalmos 75 4.416 2.2

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.300 5.6e-07
osteosarcoma -1.101 2.2e-03
ovarian cancer 1.400 8.3e-05
Pick disease 1.100 2.5e-05

Gene RIF (10)

AA Sequence

MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSVFNPPPSRPLQ      1 - 70
VNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRFIRPDPRSRVTDPVGDIVSFM     71 - 140
HSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGDDHQDSDEFCRNTLCAPEVISLINTRMLFWA    141 - 210
CSTNKPEGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLER    211 - 280
EERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECL    281 - 350
PPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW    351 - 420
PNPPTLQEAGLSHTEVLFVQDLTDE                                                 421 - 445
//

Text Mined References (26)

PMID Year Title