Property Summary

NCBI Gene PubMed Count 17
Grant Count 14
R01 Count 5
Funding $749,235.61
PubMed Score 26.90
PubTator Score 12.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.101 0.002
lung adenocarcinoma 1.300 0.000
Pick disease 1.100 0.000
ovarian cancer 1.400 0.000

Gene RIF (8)

PMID Text
24378746 role of UBXD8 in cellular responses to excess fatty acids
23720822 the UAS domain of Ubxd8 mediates it's polymerization upon interaction with long-chain unsaturated fatty acids
23297223 UBXD8-mediated recruitment of p97/VCP to LDs increases lipid droplet (LD) size by inhibiting the activity of adipose triglyceride lipase (ATGL), the rate-limiting enzyme in triacylglycerol hydrolysis.
22454508 Ubx2 and Ubxd8 regulates lipid droplet homeostasis.
22238364 These results indicate that ApoB after lipidation is dislocated from the ER lumen to the LD surface for proteasomal degradation and that Derlin-1 and UBXD8 are engaged in the predislocation and postdislocation steps, respectively.
21115839 These results suggest that Ubxd8 acts as a brake that limits triglyceride synthesis, and this brake is released when its structure is altered by exposure to unsaturated fatty acids.
20160012 These findings provide evidence for conserved ubiquitination pathways regulating the RasGAP proteins Ira2 (in yeast) and neurofibromin (in humans).
12372427 ETEA may play a role in the regulating the resistance to apoptosis that is observed in T cells and eosinophils of AD patients

AA Sequence

MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSVFNPPPSRPLQ      1 - 70
VNTADHRIYSYVVSRPQPRGLLGWGYYLIMLPFRFTYYTILDIFRFALRFIRPDPRSRVTDPVGDIVSFM     71 - 140
HSFEEKYGRAHPVFYQGTYSQALNDAKRELRFLLVYLHGDDHQDSDEFCRNTLCAPEVISLINTRMLFWA    141 - 210
CSTNKPEGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLER    211 - 280
EERNQTQVLRQQQDEAYLASLRADQEKERKKREERERKRRKEEEVQQQKLAEERRRQNLQEEKERKLECL    281 - 350
PPEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEW    351 - 420
PNPPTLQEAGLSHTEVLFVQDLTDE                                                 421 - 445
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24378746 2014 Cellular responses to excess fatty acids: focus on ubiquitin regulatory X domain-containing protein 8.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24215460 2014 Pathogenic mutation of UBQLN2 impairs its interaction with UBXD8 and disrupts endoplasmic reticulum-associated protein degradation.
23720822 2013 UAS domain of Ubxd8 and FAF1 polymerizes upon interaction with long-chain unsaturated fatty acids.
23297223 2013 Spatial regulation of UBXD8 and p97/VCP controls ATGL-mediated lipid droplet turnover.
22454508 2012 The ubiquitin-like (UBX)-domain-containing protein Ubx2/Ubxd8 regulates lipid droplet homeostasis.
22238364 2012 Derlin-1 and UBXD8 are engaged in dislocation and degradation of lipidated ApoB-100 at lipid droplets.
21269460 2011 Initial characterization of the human central proteome.
More...