Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
R01 Count 9
Funding $1,310,359.2
PubMed Score 14.79
PubTator Score 9.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (1)

PMID Text
15082789 These results place human enhancer of invasion-cluster as a novel regulator of spindle function and integrity during the metaphase-anaphase transition.

AA Sequence

MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAK      1 - 70
YLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIEL     71 - 140
EKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDA    141 - 210
SLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL      211 - 278
//

Text Mined References (17)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
19369198 2009 The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells.
More...