Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.86
PubTator Score 9.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma 1.100 5.9e-03
astrocytoma 1.200 5.2e-19
Astrocytoma, Pilocytic 1.100 5.6e-05
atypical teratoid / rhabdoid tumor 1.600 8.6e-06
ependymoma 1.400 3.2e-08
glioblastoma 1.800 1.4e-08
group 3 medulloblastoma 2.800 6.9e-07
juvenile dermatomyositis 1.187 2.3e-12
medulloblastoma, large-cell 2.000 4.7e-06
nasopharyngeal carcinoma 1.400 2.1e-03
oligodendroglioma 1.300 1.4e-11
ovarian cancer -1.500 3.4e-06
primitive neuroectodermal tumor 2.300 6.3e-07

Protein-protein Interaction (11)

Gene RIF (1)

AA Sequence

MEPQEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAK      1 - 70
YLQDLLMESVNFSPANLSSTGSRYLNALVDSAVALETKDTSLASFIPAVNDLTSDLFRTKSKSEEIKIEL     71 - 140
EKLEKNLTATLVLEKCLQEDVKKAELHLSTERAKVDNRRQNMDFLKAKSEEFRFGIKAAEEQLSARGMDA    141 - 210
SLSHQSLVALSEKLARLKQQTIPLKKKLESYLDLMPNPSLAQVKIEEAKRELDSIEAELTRRVDMMEL      211 - 278
//

Text Mined References (20)

PMID Year Title