Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.15
PubTator Score 11.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.80985459254161E-20
osteosarcoma 7933 2.10437046378225E-7
ovarian cancer 8492 5.00707257843708E-5
juvenile dermatomyositis 1189 6.22484633550578E-5
gastric cancer 436 7.4187216356866E-4
permanent atrial fibrillation 44 7.57158550423852E-4
hepatocellular carcinoma 550 0.00107269463307029
pancreatic carcinoma 567 0.00301585750410397
pancreatic cancer 2300 0.00301585750410417
Multiple myeloma 1328 0.00347092235025087
Rheumatoid Arthritis 1171 0.0037038477888701
sarcoidosis 368 0.00416305014275969
Pick disease 1893 0.00576260289201195
hereditary spastic paraplegia 313 0.00601688500726731
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0103289370436785
limb girdle muscular dystrophy 2A 156 0.0103396150424041
primitive neuroectodermal tumor 3031 0.0111620959881967
medulloblastoma, large-cell 6234 0.0215622686860598
Hydrolethalus syndrome 128 0.0283288953415756
Becker muscular dystrophy 187 0.0296942286704762
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0

Expression

  Differential Expression (20)

Synonym

Accession Q96CQ1 A8MYF7 Q05CY1 Q9H0G8 Q9NVN5
Symbols PNC2

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (4)

PMID Text
25320081 The main physiological role of SLC25A33 and SLC25A36 is to import/export pyrimidine nucleotides into and from mitochondria
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20944657 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKV      1 - 70
ILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIW     71 - 140
LIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTA    141 - 210
STMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSL    211 - 280
YRGLTTHLVRQIPNTAIMMATYELVVYLLNG                                           281 - 311
//

Text Mined References (17)

PMID Year Title
25320081 2014 The human SLC25A33 and SLC25A36 genes of solute carrier family 25 encode two mitochondrial pyrimidine nucleotide transporters.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22704111 2012 Pilot genome-wide association search identifies potential loci for risk of erectile dysfunction in type 1 diabetes using the DCCT/EDIC study cohort.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
17210862 2007 Differential expression profile prioritization of positional candidate glaucoma genes: the GLC1C locus.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...