Property Summary

NCBI Gene PubMed Count 13
Grant Count 7
R01 Count 7
Funding $575,276.68
PubMed Score 14.15
PubTator Score 11.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (4)

PMID Text
25320081 The main physiological role of SLC25A33 and SLC25A36 is to import/export pyrimidine nucleotides into and from mitochondria
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
20944657 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKV      1 - 70
ILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIW     71 - 140
LIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTA    141 - 210
STMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSL    211 - 280
YRGLTTHLVRQIPNTAIMMATYELVVYLLNG                                           281 - 311
//

Text Mined References (17)

PMID Year Title
25320081 2014 The human SLC25A33 and SLC25A36 genes of solute carrier family 25 encode two mitochondrial pyrimidine nucleotide transporters.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
22704111 2012 Pilot genome-wide association search identifies potential loci for risk of erectile dysfunction in type 1 diabetes using the DCCT/EDIC study cohort.
20944657 2011 Replication of top markers of a genome-wide association study in multiple sclerosis in Spain.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19010793 2009 Genome-wide association analysis of susceptibility and clinical phenotype in multiple sclerosis.
17210862 2007 Differential expression profile prioritization of positional candidate glaucoma genes: the GLC1C locus.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...