Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.25
PubTator Score 11.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Becker muscular dystrophy -1.233 3.0e-02
Breast cancer -1.600 1.8e-20
gastric cancer -1.400 7.4e-04
hepatocellular carcinoma -1.100 8.0e-03
hereditary spastic paraplegia -1.109 6.0e-03
Hydrolethalus syndrome 1.276 2.8e-02
juvenile dermatomyositis 1.227 6.2e-05
limb girdle muscular dystrophy 2A -1.083 1.0e-02
medulloblastoma, large-cell 1.100 2.2e-02
Multiple myeloma 1.966 3.5e-03
osteosarcoma 2.168 8.9e-07
ovarian cancer -1.900 2.3e-07
pancreatic cancer -1.200 3.0e-03
pancreatic carcinoma -1.200 3.0e-03
pancreatic ductal adenocarcinoma liver m... 1.281 6.2e-03
permanent atrial fibrillation -1.100 7.6e-04
Pick disease 1.400 5.8e-03
primitive neuroectodermal tumor 1.300 1.1e-02
Rheumatoid arthritis 2.400 3.7e-03
sarcoidosis 1.100 4.2e-03

Gene RIF (4)

AA Sequence

MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKV      1 - 70
ILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIW     71 - 140
LIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTA    141 - 210
STMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSL    211 - 280
YRGLTTHLVRQIPNTAIMMATYELVVYLLNG                                           281 - 311
//

Text Mined References (17)

PMID Year Title