Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.67
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.6e-05
osteosarcoma 7950 2.5e-04
spina bifida 1074 2.6e-02

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.120 2.5e-04
ovarian cancer 1.200 1.6e-05
spina bifida 1.046 2.6e-02

AA Sequence

MFDTTPHSGRSTPSSSPSLRKRLQLLPPSRPPPEPEPGTMVEKGSDSSSEKGGVPGTPSTQSLGSRNFIR      1 - 70
NSKKMQSWYSMLSPTYKQRNEDFRKLFSKLPEAERLIVDYSCALQREILLQGRLYLSENWICFYSNIFRW     71 - 140
ETTISIQLKEVTCLKKEKTAKLIPNAIQICTESEKHFFTSFGARDRCFLLIFRLWQNALLEKTLSPRELW    141 - 210
HLVHQCYGSELGLTSEDEDYVSPLQLNGLGTPKEVGDVIALSDITSSGAADRSQEPSPVGSRRGHVTPNL    211 - 280
SRASSDADHGAEEDKEEQVDSQPDASSSQTVTPVAEPPSTEPTQPDGPTTLGPLDLLPSEELLTDTSNSS    281 - 350
SSTGEEADLAALLPDLSGRLLINSVFHVGAERLQQMLFSDSPFLQGFLQQCKFTDVTLSPWSGDSKCHQR    351 - 420
RVLTYTIPISNPLGPKSASVVETQTLFRRGPQAGGCVVDSEVLTQGIPYQDYFYTAHRYCILGLARNKAR    421 - 490
LRVSSEIRYRKQPWSLVKSLIEKNSWSGIEDYFHHLERELAKAEKLSLEEGGKDARGLLSGLRRRKRPLS    491 - 560
WRAHGDGPQHPDPDPCARAGIHTSGSLSSRFSEPSVDQGPGAGIPSALVLISIVICVSLIILIALNVLLF    561 - 630
YRLWSLERTAHTFESWHSLALAKGKFPQTATEWAEILALQKQFHSVEVHKWRQILRASVELLDEMKFSLE    631 - 700
KLHQGITVSDPPFDTQPRPDDSFS                                                  701 - 724
//

Text Mined References (14)

PMID Year Title