Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.54
PubTator Score 1.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.800 0.000
medulloblastoma, large-cell 1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.816 0.003
ovarian cancer -1.800 0.000
dermatomyositis 1.200 0.003

AA Sequence

MAAAEPAVLALPNSGAGGAGAPSGTVPVLFCFSVFARPSSVPHGAGYELLIQKFLSLYGDQIDMHRKFVV      1 - 70
QLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCCDMQERFRPAIKYFGDIISVG     71 - 140
QRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGV    141 - 210
ETHVCIQQTALELVGRGVEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKE    211 - 280
IQNLIKASAPESGLLSKV                                                        281 - 298
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
18566572 2008 Microarray study of gene expression in uterine leiomyoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14561759 2004 Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.