Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.56
PubTator Score 1.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
dermatomyositis 1.200 3.2e-03
medulloblastoma, large-cell 1.300 8.1e-04
ovarian cancer -1.800 2.1e-04
pancreatic ductal adenocarcinoma liver m... -1.816 3.3e-03
psoriasis 1.800 3.2e-04

Synonym

Accession Q96CN7 Q7Z770
Symbols CGI-111

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAAAEPAVLALPNSGAGGAGAPSGTVPVLFCFSVFARPSSVPHGAGYELLIQKFLSLYGDQIDMHRKFVV      1 - 70
QLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCCDMQERFRPAIKYFGDIISVG     71 - 140
QRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGV    141 - 210
ETHVCIQQTALELVGRGVEVHIVADATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKE    211 - 280
IQNLIKASAPESGLLSKV                                                        281 - 298
//

Text Mined References (9)

PMID Year Title