Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.75
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 7.5e-13

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 1.100 7.5e-13

Gene RIF (1)

AA Sequence

MEEFRRSYSRLCRESGAEPQEAVLQQLHQLPRGRLDLATQSLTVETCRALGKLLPRETLCTELVLSDCML      1 - 70
SEEGATLLLRGLCANTVLRFLDLKGNNLRAAGAEALGKLLQQNKSIQSLTLEWNSLGTWDDAFATFCGGL     71 - 140
AANGALQRLDLRNNQISHKGAEELALALKGNTTLQQLDLRWNNVGLLGGRALMNCLPSNRTLWRLDLAGN    141 - 210
NIPGDVLRAVEQAMGHSQDRLTTFQENQARTHVLSKEVQHLREEKSKQFLDLMETIDKQREEMAKSSRAS    211 - 280
AARVGQLQEALNERHSIINALKAKLQMTEAALALSEQKAQDLGELLATAEQEQLSLSQRQAKELKLEQQE    281 - 350
AAERESKLLRDLSAANEKNLLLQNQVDELERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERLDMEKR    351 - 420
RCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSERGQAEEELIKA    421 - 490
KSQARLEEQQRLAHLEDKLRLLAQARDEAQGACLQQKQVVAEAQTRVSQLGLQVEGLRRRLEELQQELSL    491 - 560
KDQERVAEVSRVRVELQEQNGRLQAELAAQEALREKAAALERQLKVMASDHREALLDRESENASLREKLR    561 - 630
LREAEIARIRDEEAQRASFLQNAVLAYVQASPVRTLSPPK                                  631 - 670
//

Text Mined References (5)

PMID Year Title