Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
Funding $242,509.34
PubMed Score 3.39
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
nephrosclerosis -1.762 0.006
malignant mesothelioma -1.600 0.000
psoriasis -1.400 0.000
group 4 medulloblastoma -1.300 0.000
medulloblastoma, large-cell -1.100 0.002
adrenocortical carcinoma -1.338 0.000
active Crohn's disease -1.799 0.002
ulcerative colitis -2.700 0.000
interstitial cystitis -1.800 0.000
lung carcinoma -1.700 0.000

Synonym

Accession Q96CM8 B4DFQ6 B4DHT5 B4DUF5 Q9H7G2
Symbols ACSMW
AVYV493

Gene

PANTHER Protein Class (2)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVYVGMLRLGRLCAGSSGVLGARAALSRSWQEARLQGVRFLSSREVDRMVSTPIGGLSYVQGCTKKHLN      1 - 70
SKTVGQCLETTAQRVPEREALVVLHEDVRLTFAQLKEEVDKAASGLLSIGLCKGDRLGMWGPNSYAWVLM     71 - 140
QLATAQAGIILVSVNPAYQAMELEYVLKKVGCKALVFPKQFKTQQYYNVLKQICPEVENAQPGALKSQRL    141 - 210
PDLTTVISVDAPLPGTLLLDEVVAAGSTRQHLDQLQYNQQFLSCHDPINIQFTSGTTGSPKGATLSHYNI    211 - 280
VNNSNILGERLKLHEKTPEQLRMILPNPLYHCLGSVAGTMMCLMYGATLILASPIFNGKKALEAISRERG    281 - 350
TFLYGTPTMFVDILNQPDFSSYDISTMCGGVIAGSPAPPELIRAIINKINMKDLVVAYGTTENSPVTFAH    351 - 420
FPEDTVEQKAESVGRIMPHTEARIMNMEAGTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYW    421 - 490
TGDVATMNEQGFCKIVGRSKDMIIRGGENIYPAELEDFFHTHPKVQEVQVVGVKDDRMGEEICACIRLKD    491 - 560
GEETTVEEIKAFCKGKISHFKIPKYIVFVTNYPLTISGKIQKFKLREQMERHLNL                   561 - 615
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17762044 2007 Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16380219 2006 Identification of novel PPARgamma target genes in primary human adipocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...