Property Summary

NCBI Gene PubMed Count 11
Grant Count 8
R01 Count 4
Funding $489,030
PubMed Score 14.50
PubTator Score 16.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (8)

PMID Text
25957687 Study shows that RdCVF acts through binding to Basigin-1 (BSG1), a transmembrane protein expressed specifically by photoreceptors. BSG1 binds to the glucose transporter GLUT1, resulting in increased glucose entry into cones.
21079812 Data suggest a critical role for TXNL6 in MsrA repair of essential lens proteins under oxidative stress conditions and that TXNL6 is important for MsrA defense protection against cataract.
20949100 regulation of the Nucleoredoxin-like genes involves a CRX responsive element that can act as both as a positive regulator of promoter activity and as a modulator of cell-type specificity
19843539 CHX10 regulates RdCVF promoter activity in the inner retina.
19402160 Observational study of gene-disease association. (HuGE Navigator)
18474255 TXNL6 probably protects retinal cells from photooxidative damage-induced apoptosis via upregulation of NF-kappaB activity
17249548 RdCVF variants have roles in leber congenital amaurosis
15220920 is a truncated thioredoxin-like protein specifically expressed by photoreceptors. The identification of this protein offers new treatment possibilities for retinitis pigmentosa

AA Sequence

MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRA      1 - 70
AQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADE     71 - 140
IQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGG    141 - 210
LF                                                                        211 - 212
//

Text Mined References (12)

PMID Year Title
25957687 2015 Rod-derived cone viability factor promotes cone survival by stimulating aerobic glycolysis.
21079812 2010 TXNL6 is a novel oxidative stress-induced reducing system for methionine sulfoxide reductase a repair of ?-crystallin and cytochrome C in the eye lens.
20949100 2010 Expression of rod-derived cone viability factor: dual role of CRX in regulating promoter activity and cell-type specificity.
19843539 2010 The homeobox gene CHX10/VSX2 regulates RdCVF promoter activity in the inner retina.
19402160 2009 BBS7 and TTC8 (BBS8) mutations play a minor role in the mutational load of Bardet-Biedl syndrome in a multiethnic population.
18474255 2008 Thioredoxin-like 6 protects retinal cell line from photooxidative damage by upregulating NF-kappaB activity.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
17249548 2006 Disease-associated variants of the rod-derived cone viability factor (RdCVF) in Leber congenital amaurosis. Rod-derived cone viability variants in LCA.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...