Property Summary

NCBI Gene PubMed Count 11
PubMed Score 14.84
PubTator Score 16.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.8e-03
Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 4.636 2.3
Blindness 88 3.196 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 8.8e-03

Synonym

Accession Q96CM4 Q0QD37
Symbols RDCVF
TXNL6

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (8)

AA Sequence

MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRA      1 - 70
AQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADE     71 - 140
IQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGG    141 - 210
LF                                                                        211 - 212
//

Text Mined References (12)

PMID Year Title