Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.9e-04
cystic fibrosis 1696 3.2e-04
ovarian cancer 8520 4.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Congestive heart failure 113 0.0 1.2

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis 1.041 3.2e-04
osteosarcoma -1.000 1.9e-04
ovarian cancer -1.100 4.5e-04

Gene RIF (2)

AA Sequence

MAAPRWSASGPWIRGNGQGCGSLFTLVSKPFCAAAAASTAINAQRLAEKLRAQKREQDTKKEPVSTNAVQ      1 - 70
RRVQEIVRFTRQLQRVHPNVLAKALTRGILHQDKNLVVINKPYGLPVHGGPGVQLCITDVLPILAKMLHG     71 - 140
HKAEPLHLCHRLDKETTGVMVLAWDKDMAHQVQELFRTRQVVKKYWAITVHVPMPSAGVVDIPIVEKEAQ    141 - 210
GQQQHHKMTLSPSYRMDDGKMVKVRRSRNAQVAVTQYQVLSSTLSSALVELQPITGIKHQLRVHLSFGLD    211 - 280
CPILGDHKYSDWNRLAPQKLSVGTLKKLGLEQSKARYIPLHLHARQLILPALGSGKEELNLVCKLPRFFV    281 - 350
HSLHRLRLEMPNEDQNENNEAKCLGAQ                                               351 - 377
//

Text Mined References (16)

PMID Year Title