Property Summary

NCBI Gene PubMed Count 22
Grant Count 989
R01 Count 87
Funding $478,039,118.48
PubMed Score 95.07
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.596 0.010
malignant mesothelioma -1.200 0.000
oligodendroglioma -1.100 0.042
cutaneous lupus erythematosus 1.900 0.009
osteosarcoma -3.099 0.000
group 3 medulloblastoma -1.500 0.000
periodontitis 1.600 0.000
tuberculosis 1.900 0.000
interstitial cystitis 2.000 0.001
primary Sjogren syndrome 1.400 0.006
ulcerative colitis 2.300 0.000
pituitary cancer -1.600 0.000

Synonym

Accession Q96CJ1 Q9NZ82
Symbols U19
BM040
TRAITS

Gene

Gene RIF (12)

PMID Text
26370086 EAF2 binding does not alter Smad3 phosphorylation but causes Smad3 cytoplasmic retention, competes with Smad4 for binding to Smad3, and prevents p300-Smad3 complex formation
25808853 Findings suggest that regulation of the AR signaling pathway, cell proliferation, and migration through FOXA1 represents an important mechanism of EAF2 suppression of prostate carcinogenesis.
24727455 Together these findings identify a novel physical and functional interaction between EAF2 and the Rb pathway.
24421387 EAF2 bound to and suppressed HIF-1alpha.
21483694 the role of the EAF2 in response to simvastatin and lovastatin in HCT-116 colon cancer cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20161747 Findings provide the first convincing line of evidence that EAF and Wnt4 form an auto-regulatory negative feedback loop in vivo.
19826414 Data suggest that U19/EAF2 regulates the expression of TSP-1 via blocking p53 repression of the TSP-1 promoter.
17395368 FB1 is an important binding partner and a functional regulator of U19/EAF2, EAF1, and/or ELL.
16114057 ELL may be an important factor required for U19/Eaf2 function because U19/Eaf2 nuclear localization and transactivation activity are essential for its function as a transcription factor.
More...

AA Sequence

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGST      1 - 70
PPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNL     71 - 140
VKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTG    141 - 210
NCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD                        211 - 260
//

Text Mined References (25)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26370086 2015 ELL Protein-associated Factor 2 (EAF2) Inhibits Transforming Growth Factor ? Signaling through a Direct Interaction with Smad3.
25808853 2015 FOXA1 modulates EAF2 regulation of AR transcriptional activity, cell proliferation, and migration in prostate cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
24727455 2014 Identification of a genetic interaction between the tumor suppressor EAF2 and the retinoblastoma protein (Rb) signaling pathway in C. elegans and prostate cancer cells.
24421387 2014 EAF2 suppresses hypoxia-induced factor 1? transcriptional activity by disrupting its interaction with coactivator CBP/p300.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21483694 2011 NCI60 cancer cell line panel data and RNAi analysis help identify EAF2 as a modulator of simvastatin and lovastatin response in HCT-116 cells.
More...