Property Summary

NCBI Gene PubMed Count 24
PubMed Score 181.51
PubTator Score 11.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 8.6e-03
group 3 medulloblastoma -1.500 4.5e-05
interstitial cystitis 1.800 1.3e-02
malignant mesothelioma -1.200 2.0e-05
oligodendroglioma -1.100 4.2e-02
osteosarcoma -1.091 8.2e-06
periodontitis 1.600 3.8e-24
pituitary cancer -1.600 2.4e-06
primary Sjogren syndrome 1.400 6.0e-03
tuberculosis 1.900 8.7e-06
ulcerative colitis 2.300 4.6e-06
Waldenstrons macroglobulinemia -1.596 1.0e-02

Gene RIF (14)

AA Sequence

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGST      1 - 70
PPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNL     71 - 140
VKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTG    141 - 210
NCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD                        211 - 260
//

Text Mined References (27)

PMID Year Title