Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.66
PubTator Score 8.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96CG3
Symbols T2BP
T6BP
TIFAA

Gene

PDB

4YM4   4ZGI  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (6)

AA Sequence

MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQF      1 - 70
SLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQ     71 - 140
FILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES                              141 - 184
//

Text Mined References (22)

PMID Year Title