Property Summary

NCBI Gene PubMed Count 15
Grant Count 9
R01 Count 4
Funding $591,337.95
PubMed Score 7.03
PubTator Score 8.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

PMID Text
26389808 This study reports the crystal structures of TIFA (residues 1-150, with the unstructured C-terminal tail truncated) and its complex with the N-terminal phosphothreonine9 peptide (residues 1-15).
26068852 an innate immune signaling axis, mediated by phosphorylation-dependent oligomerization of the TRAF-interacting protein with forkhead-associated domain (TIFA) that is triggered by heptose-1,7-bisphosphate.
22566686 identify a novel threonine phosphorylation site on TIFA and show that this phosphorylated threonine binds with the FHA domain of TIFA, leading to TIFA oligomerization and TIFA-mediated NF-kappaB activation
20332099 Observational study of gene-disease association. (HuGE Navigator)
15492226 TIFA induces the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism

AA Sequence

MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQF      1 - 70
SLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQ     71 - 140
FILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES                              141 - 184
//

Text Mined References (20)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26389808 2015 Uncovering the Mechanism of Forkhead-Associated Domain-Mediated TIFA Oligomerization That Plays a Central Role in Immune Responses.
26068852 2015 INNATE IMMUNITY. Cytosolic detection of the bacterial metabolite HBP activates TIFA-dependent innate immunity.
25416956 2014 A proteome-scale map of the human interactome network.
22566686 2012 Intermolecular binding between TIFA-FHA and TIFA-pT mediates tumor necrosis factor alpha stimulation and NF-?B activation.
21269460 2011 Initial characterization of the human central proteome.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
16643855 2006 A novel Zinc finger protein, ZCCHC11, interacts with TIFA and modulates TLR signaling.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...