Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.66
PubTator Score 8.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

AA Sequence

MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQF      1 - 70
SLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQ     71 - 140
FILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES                              141 - 184
//

Text Mined References (22)

PMID Year Title