Property Summary

NCBI Gene PubMed Count 26
PubMed Score 7.74
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Ovarian Neoplasms 102 0.0 0.0
Disease Target Count
ovarian neoplasm 99
Disease Target Count P-value
Atopic dermatitis 952 4.3e-04
interstitial cystitis 2312 4.9e-03
invasive ductal carcinoma 2951 3.2e-02
spina bifida 1074 4.7e-02
Disease Target Count Z-score Confidence
ovarian cancer 8520 0.0 6.29520842193169E-11

Expression

  Differential Expression (5)

Disease log2 FC p
ovarian cancer 3.000 6.3e-11
Atopic dermatitis -1.200 4.3e-04
interstitial cystitis -2.800 4.9e-03
invasive ductal carcinoma 2.600 3.2e-02
spina bifida -3.169 4.7e-02

Gene RIF (15)

AA Sequence

MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK      1 - 70
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD     71 - 140
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS    141 - 210
RAASSQRAEEEDDDIKQLAAWAT                                                   211 - 233
//

Text Mined References (28)

PMID Year Title