Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.10
PubTator Score 6.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.200 0.000
interstitial cystitis -3.600 0.000
spina bifida -3.169 0.047
invasive ductal carcinoma 2.600 0.032
ovarian cancer 3.000 0.000

Synonym

Accession Q96CF2 B2RBZ1
Symbols Shax3
SNF7-3
VPS32C

Gene

PANTHER Protein Class (1)

PDB

3C3R  

Gene RIF (18)

PMID Text
26929449 The ESCRT-III subunit CHMP4B is a key effector in abscission, whereas its paralogue, CHMP4C, is a component in the abscission checkpoint that delays abscission until chromatin is cleared from the intercellular bridge.
26712741 CHMP4C mediates radiation resistance in lung cancer cells.
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
23535730 Single nucleotide polymorphisms in CHMP4C gene is associated with ovarian cancer.
22724069 AURKB phosphorylates CHMP4C at 3 serines its C-terminal tail.Phosphorylation at these sites appears essential for CHMP4C function because their mutation leads to cytokinesis defects.
22422861 findings show CHMP4C is involved in abscission timing; this function correlated with its differential spatiotemporal distribution during late stages of cytokinesis; CHMP4C functioned in the Aurora B-dependent abscission checkpoint
21762798 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21762796 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21494275 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
More...

AA Sequence

MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK      1 - 70
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD     71 - 140
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS    141 - 210
RAASSQRAEEEDDDIKQLAAWAT                                                   211 - 233
//

Text Mined References (25)

PMID Year Title
26929449 2016 ALIX and ESCRT-I/II function as parallel ESCRT-III recruiters in cytokinetic abscission.
26712741 2015 CHMP4C Disruption Sensitizes the Human Lung Cancer Cells to Irradiation.
24814515 2014 ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22724069 2012 The chromosomal passenger complex controls the function of endosomal sorting complex required for transport-III Snf7 proteins during cytokinesis.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22547407 2012 ALIX binds a YPX(3)L motif of the GPCR PAR1 and mediates ubiquitin-independent ESCRT-III/MVB sorting.
22422861 2012 ESCRT-III governs the Aurora B-mediated abscission checkpoint through CHMP4C.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
More...