Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $3,000,000
PubMed Score 28.05
PubTator Score 6.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.619 0.000
tuberculosis and treatment for 3 months -1.300 0.000
ovarian cancer 1.200 0.001

Synonym

Accession Q96CD2 Q96SX0 Q9HC17 PPC-DC
Symbols coaC
MDS018
PPC-DC

Gene

 Grant Application (1)

PDB

1QZU  

AA Sequence

MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLY      1 - 70
SDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMN     71 - 140
TAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS          141 - 204
//

Text Mined References (12)

PMID Year Title
26514574 2015 Complex stability and dynamic subunit interchange modulates the disparate activities of the yeast moonlighting proteins Hal3 and Vhs3.
25416956 2014 A proteome-scale map of the human interactome network.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15581364 2004 Mechanistic studies on phosphopantothenoylcysteine decarboxylase: trapping of an enethiolate intermediate with a mechanism-based inactivating agent.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14501115 2003 Unusual space-group pseudosymmetry in crystals of human phosphopantothenoylcysteine decarboxylase.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...