Property Summary

NCBI Gene PubMed Count 12
PubMed Score 30.32
PubTator Score 6.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.619 1.4e-07
ovarian cancer 1.200 1.2e-03
tuberculosis -1.200 3.1e-05

AA Sequence

MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLY      1 - 70
SDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMN     71 - 140
TAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS          141 - 204
//

Text Mined References (13)

PMID Year Title