Property Summary

NCBI Gene PubMed Count 11
PubMed Score 28.05
PubTator Score 6.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 1.36829544951327E-7
tuberculosis and treatment for 3 months 327 3.79416773327253E-4
ovarian cancer 8492 0.00120807674496952
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 1.0
Disease Target Count Z-score Confidence
Obstructive sleep apnea 28 3.137 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.619 0.000
tuberculosis and treatment for 3 months -1.300 0.000
ovarian cancer 1.200 0.001

Synonym

Accession Q96CD2 Q96SX0 Q9HC17 PPC-DC
Symbols coaC
MDS018
PPC-DC

Gene

PDB

1QZU  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

AA Sequence

MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFYSPQDIPVTLY      1 - 70
SDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLLTCVMRAWDRSKPLLFCPAMN     71 - 140
TAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGAMAEVGTIVDKVKEVLFQHSGFQQS          141 - 204
//

Text Mined References (12)

PMID Year Title
26514574 2015 Complex stability and dynamic subunit interchange modulates the disparate activities of the yeast moonlighting proteins Hal3 and Vhs3.
25416956 2014 A proteome-scale map of the human interactome network.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15581364 2004 Mechanistic studies on phosphopantothenoylcysteine decarboxylase: trapping of an enethiolate intermediate with a mechanism-based inactivating agent.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14501115 2003 Unusual space-group pseudosymmetry in crystals of human phosphopantothenoylcysteine decarboxylase.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...