Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDH      1 - 70
IHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHL     71 - 140
DLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEA    141 - 210
LAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAAL    211 - 280
RLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAH    281 - 350
CPRLRTYTLKLTREPHPWRPTLVA                                                  351 - 374
//

Text Mined References (11)

PMID Year Title