Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96CD0 Q9NUM0
Symbols FBL8

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDH      1 - 70
IHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHL     71 - 140
DLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEA    141 - 210
LAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAAL    211 - 280
RLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAH    281 - 350
CPRLRTYTLKLTREPHPWRPTLVA                                                  351 - 374
//

Text Mined References (11)

PMID Year Title