Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.39
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 5.0e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.616 5.0e-05

Gene RIF (3)

AA Sequence

MAALTLRGVRELLKRVDLATVPRRHRYKKKWAATEPKFPAVRLALQNFDMTYSVQFGDLWPSIRVSLLSE      1 - 70
QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSPASWACSPNLRCFTFDRGDIS     71 - 140
RFPPARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDLCAAPGGKTLALLQTGCCRNLAANDLSPSRI    141 - 210
ARLQKILHSYVPEEIRDGNQVRVTSWDGRKWGELEGDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKE    211 - 280
RQILPVLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLANQYSIQVQVEDLTHFRRVFMD    281 - 350
TFCFFSSCQVGELVIPNLMANFGPMYFCKMRRLT                                        351 - 384
//

Text Mined References (16)

PMID Year Title