Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.39
PubTator Score 3.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.616 0.000

Synonym

Accession Q96CB9 A8K6S6 B3KQ50 B4DHA4 Q5TDF7 Q96AN8 Q9HAJ8
Symbols SHTAP

Gene

PDB

4FP9   4FZV  

Gene RIF (3)

PMID Text
24387984 It involves in epigenetic changes during the progression of Alzheimer disease pathology.
22949673 analysis of the 3D crystal structure of the human MTERF4-NSUN4 complex
19086053 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAALTLRGVRELLKRVDLATVPRRHRYKKKWAATEPKFPAVRLALQNFDMTYSVQFGDLWPSIRVSLLSE      1 - 70
QKYGALVNNFAAWDHVSAKLEQLSAKDFVNEAISHWELQSEGGQSAAPSPASWACSPNLRCFTFDRGDIS     71 - 140
RFPPARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDLCAAPGGKTLALLQTGCCRNLAANDLSPSRI    141 - 210
ARLQKILHSYVPEEIRDGNQVRVTSWDGRKWGELEGDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKE    211 - 280
RQILPVLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQGAIELLANQYSIQVQVEDLTHFRRVFMD    281 - 350
TFCFFSSCQVGELVIPNLMANFGPMYFCKMRRLT                                        351 - 384
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24387984 2014 Global changes in DNA methylation and hydroxymethylation in Alzheimer's disease human brain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23022348 2012 Structure of the essential MTERF4:NSUN4 protein complex reveals how an MTERF protein collaborates to facilitate rRNA modification.
22949673 2012 Structure of the human MTERF4-NSUN4 protein complex that regulates mitochondrial ribosome biogenesis.
21531335 2011 MTERF4 regulates translation by targeting the methyltransferase NSUN4 to the mammalian mitochondrial ribosome.
21269460 2011 Initial characterization of the human central proteome.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...