Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.01
PubTator Score 4.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.5e-06
group 3 medulloblastoma 4104 2.8e-04
glioblastoma 5792 6.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.300 6.2e-04
group 3 medulloblastoma 1.100 2.8e-04
ovarian cancer -1.200 1.5e-06

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKISSTKNISIKQE      1 - 70
PKISSSLPSGNNNGKVLTTEKVKKEAEKRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPM     71 - 140
ADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCHKPQVTDKEANDPRLVWYCA    141 - 210
RCTRQMKRMAQKTQKPPQKPAPAVVSVTPAVKDPLVKKPETKLKQETTFLAFKRTEVKTSTVISGNSSSA    211 - 280
SVSSSVTSGLTGWAAFAAKTSSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGS    281 - 350
NNSTTPTVPLKPPPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGSSSQLSGNGNSGTSGPSGSTTSKT    351 - 420
TSESSSSPSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK                                421 - 462
//

Text Mined References (22)

PMID Year Title