Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.19
PubTator Score 4.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.300 0.001
group 3 medulloblastoma 1.100 0.000
ovarian cancer 1.500 0.001

Synonym

Accession Q96CB8 B2RC48 Q3B6Z3 Q9HD71 Int12
Symbols INT12
PHF22
SBBI22

Gene

 GO Function (1)

Gene RIF (4)

PMID Text
24058608 In fixed sections of human lung tissue, GSTCD protein expression was ubiquitous, whereas INTS12 expression was predominantly in epithelial cells and pneumocytes.
20332099 Observational study of gene-disease association. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of integrator complex subunit 12 (INTS12; SBBI22) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAATVNLELDPIFLKALGFLHSKSKDSAEKLKALLDESLARGIDSSYRPSQKDVEPPKISSTKNISIKQE      1 - 70
PKISSSLPSGNNNGKVLTTEKVKKEAEKRPADKMKSDITEGVDIPKKPRLEKPETQSSPITVQSSKDLPM     71 - 140
ADLSSFEETSADDFAMEMGLACVVCRQMMVASGNQLVECQECHNLYHRDCHKPQVTDKEANDPRLVWYCA    141 - 210
RCTRQMKRMAQKTQKPPQKPAPAVVSVTPAVKDPLVKKPETKLKQETTFLAFKRTEVKTSTVISGNSSSA    211 - 280
SVSSSVTSGLTGWAAFAAKTSSAGPSTAKLSSTTQNNTGKPATSSANQKPVGLTGLATSSKGGIGSKIGS    281 - 350
NNSTTPTVPLKPPPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGSSSQLSGNGNSGTSGPSGSTTSKT    351 - 420
TSESSSSPSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK                                421 - 462
//

Text Mined References (18)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24058608 2013 GSTCD and INTS12 regulation and expression in the human lung.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...