Property Summary

NCBI Gene PubMed Count 105
Grant Count 29
R01 Count 17
Funding $6,604,045.29
PubMed Score 194.05
PubTator Score 201.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 0.000

Gene RIF (94)

PMID Text
26823716 Expression of livin, survivin and caspase-3 are closely related to the occurrence and development of prostatic cancer.
26708654 The apoptosisinducing effects of livin and surivin knockdown were investigated using a Hoechst staining kit.
26412467 Our results suggested the important role of Livin and its partner molecule in the process of VSV treatment
26122233 Livin expression was higher in condyloma acuminatum than in normal cells and was correlated with survivin and Ki-67.
26094984 Data showed that Livin knock-down suppressed cell proliferation and inhibited cell invasion, accompanied by downregulation of VEGF and MMP-2/-9. Its silencing resulted in the prevention of xenograft tumor formation.
25695324 These findings suggest that livin may be used as a novel target for tumor gene therapy.
25374170 Livin gene has a high expression in osteosarcoma and inhibits apoptosis in tumor tissue.
25370472 Upregulation of Livin expression and downregulation of caspase activity are observed under cycling and chronic hypoxia in glioblastoma cells and xenografts.
25339450 These data suggest that livin overexpression plays an important role in tumor invasiveness by mediating resistance to apoptosis.
25261663 Co-silencing of Livin and Survivin can effectively inhibit the cell proliferation and apoptosis of lung cancer cells.
More...

AA Sequence

MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEEEEG      1 - 70
AGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDP     71 - 140
WTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPWEEPEDAAPVAPSVPASGYPELPTPRREVQS    141 - 210
ESAQEPGGVSPAEAQRAWWVLEPPGARDVEAQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQ    211 - 280
LCPICRAPVRSRVRTFLS                                                        281 - 298
//

Text Mined References (107)

PMID Year Title
26823716 2015 Expression of livin, survivin and caspase-3 in prostatic cancer and their clinical significance.
26708654 2016 Effects of RNA interference-mediated knockdown of livin and survivin using monomethoxypolyethylene glycol-chitosan nanoparticles in MG-63 osteosarcoma cells.
26412467 2015 Livin modulates the apoptotic effects of vesicular stomatotitis virus in lung adenocarcinoma.
26122233 EXPRESSION AND CLINICAL SIGNIFICANCE OF APOPTOSIS-ASSOCIATED PROTEINS SURVIVIN AND LIVIN IN CONDYLOMA ACUMINATUM.
26094984 2015 Silencing of Livin inhibits tumorigenesis and metastasis via VEGF and MMPs pathway in lung cancer.
25695324 2015 Inhibition of livin expression suppresses cell proliferation and enhances chemosensitivity to cisplatin in human lung adenocarcinoma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25374170 2014 Research progress on the livin gene and osteosarcomas.
25370472 2015 Livin contributes to tumor hypoxia-induced resistance to cytotoxic therapies in glioblastoma multiforme.
25339450 2014 Expression of the apoptosis inhibitor livin in colorectal adenoma-carcinoma sequence: correlations with pathology and outcome.
More...