Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.95
PubTator Score 3.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.100 2.1e-07
group 3 medulloblastoma 1.100 1.0e-03
interstitial lung disease 1.100 1.2e-02
intraductal papillary-mucinous adenoma (... 1.100 3.0e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-02
lung cancer 1.300 6.0e-04
osteosarcoma 2.652 1.9e-06
ovarian cancer -1.200 1.1e-07
psoriasis 1.200 9.0e-04

Gene RIF (3)

AA Sequence

MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMCYVPSPVLASV      1 - 70
GDTDFGYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNLGLSKEDPASRIYAKEASRHS     71 - 140
LGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCST    141 - 210
YLSFFSTPSELAGPESLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSK    211 - 280
LRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQ    281 - 350
EISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILK    351 - 420
SIDRISEVKDEEEDS                                                           421 - 435
//

Text Mined References (16)

PMID Year Title