Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.00
PubTator Score 3.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
interstitial lung disease 1.100 0.012
psoriasis 1.200 0.001
osteosarcoma 2.652 0.000
glioblastoma 1.100 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.030
intraductal papillary-mucinous neoplasm ... 1.200 0.016
lung cancer 1.300 0.001
group 3 medulloblastoma 1.100 0.001
ovarian cancer -1.200 0.000

Synonym

Gene

Gene RIF (3)

PMID Text
25496667 Genome-wide shRNA screening identifies SDCCAG3, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23108400 The novel endosomal protein SDCCAG3 forms a complex with PTPN13 & interacts with GIT1. Interaction of SDCCAG3 with PTPN13 is mediated by the PTPN13 FERM domain & the SDCCAG3 N-terminus. SDCCAG3 expression levels are elevated in colon cancers.
16332174 SDCCAG3 is important for protein trafficking and presentation of TNFR1 on the cell surface.

AA Sequence

MSGYQRRPGATPLSRARSLAIPDAPAFYERRSCLPQLNCERPHGRDLDSPFFGIRPAFMCYVPSPVLASV      1 - 70
GDTDFGYGKGKCSKQSPSGAHGTHFGDDRFEDLEEANPFSFREFLKTKNLGLSKEDPASRIYAKEASRHS     71 - 140
LGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDEDTGWSGAYLPSAIEQTHPERVPAGTSPCST    141 - 210
YLSFFSTPSELAGPESLPSWALSDTDSRVSPASPAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSK    211 - 280
LRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQ    281 - 350
EISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNSAQASIKQLVSGAETLNLVAEILK    351 - 420
SIDRISEVKDEEEDS                                                           421 - 435
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25278552 2014 Identification of molecular heterogeneity in SNX27-retromer-mediated endosome-to-plasma-membrane recycling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23108400 2013 The serologically defined colon cancer antigen-3 interacts with the protein tyrosine phosphatase PTPN13 and is involved in the regulation of cytokinesis.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...