Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.58
PubTator Score 118.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
lung adenocarcinoma 2714 1.41533829282638E-13
Breast cancer 3099 5.47509234345742E-6
breast carcinoma 1614 1.21533693184608E-4
Disease Target Count Z-score Confidence
Ovarian clear cell carcinoma 1 3.545 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.900 0.000
lung adenocarcinoma 1.800 0.000
Breast cancer 1.400 0.000

Synonym

Accession Q96C90 Q504S7 Q7KZD7
Symbols PNG
PHI-1
PLCB3N
SOM172

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15522888 PHI-1 participates in regulatory events at the trailing edge of migrating cells and modulates retraction of endothelial and epithelial cells
15083373 Whereas CPI-17 staining was diffuse, PHI-1 was concentrated along the cell membrane in distinct foci. The common tissue distribution but different cellular localization of PHI-1 and CPI-17 suggest distinctive physiological roles for these PP1 inhibitors.
10606530 An inhibitory phosphoprotein that inhibits the myosin- and glycogen-associated holoenzyme versions of protein type-1 phosphatase (PP1) as well as the monomeric catalytic subunit of PP1 in multiple tissues.

AA Sequence

MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLN      1 - 70
LEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQK     71 - 140
LSTPQKK                                                                   141 - 147
//

Text Mined References (19)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...