Property Summary

NCBI Gene PubMed Count 26
Grant Count 41
R01 Count 21
Funding $7,942,250.18
PubMed Score 332.00
PubTator Score 69.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.318 0.002
pancreatic ductal adenocarcinoma liver m... -1.356 0.008
lung cancer 1.400 0.000
ulcerative colitis 1.100 0.000

Gene RIF (13)

PMID Text
26584588 Data show that decapping scavenger enzyme DcpS (DcpS) is a nucleocytoplasmic shuttling protein that activates microRNA (miRNA) degradation.
26241964 In DcpS, conformational change is dominated by an anti-symmetric cooperative motion, causing one active site to close as the other opens; however a symmetric motion is also significant.
26001796 data demonstrate that DcpS in conjunction with Xrn1 has the potential to regulate RNA stability in a transcript-selective manner in mammalian cells
25712129 DCPS and more generally RNA catabolism, are critical for neurological development, normal cognition and organismal homeostasis in humans.
25701870 In vitro decapping assays showed that altered EDC3 is unable to enhance DCP2 decapping at low concentrations and even inhibits DCP2 decapping at high concentration.
18725266 Data established that DcpS, a key enzyme in mRNA decay, is a new target of DeltaLf transcriptional activity.
18441014 biochemical analysis of the dynamic and mutually exclusive cap hydrolysis activity of the two cap binding sites of DcpS
18426921 These studies demonstrate that the significance of DcpS extends beyond its well-characterized role in mRNA decay and involves a broader range of functions in RNA processing including nuclear pre-mRNA splicing.
16140270 Furthermore, we show that a novel human histidine triad protein DCS-1, which is expressed together with NR1 in many tissues, can significantly reduce menadione-induced cytotoxicity in these cells
15769464 crystal structures of DcpS in ligand-free form and in a complex with m7GDP
More...

AA Sequence

MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNE      1 - 70
ASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHL     71 - 140
QKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQ    141 - 210
QQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHF    211 - 280
TALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS                 281 - 337
//

Text Mined References (33)

PMID Year Title
26584588 2015 The human decapping scavenger enzyme DcpS modulates microRNA turnover.
26241964 2015 Structure and Function in Homodimeric Enzymes: Simulations of Cooperative and Independent Functional Motions.
26001796 2015 DcpS is a transcript-specific modulator of RNA in mammalian cells.
25712129 2015 Loss of the scavenger mRNA decapping enzyme DCPS causes syndromic intellectual disability with neuromuscular defects.
25701870 2015 Mutations in DCPS and EDC3 in autosomal recessive intellectual disability indicate a crucial role for mRNA decapping in neurodevelopment.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22985415 2012 7-methylguanosine diphosphate (m(7)GDP) is not hydrolyzed but strongly bound by decapping scavenger (DcpS) enzymes and potently inhibits their activity.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...