Property Summary

NCBI Gene PubMed Count 29
PubMed Score 366.06
PubTator Score 69.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.400 3.3e-04
osteosarcoma -1.318 1.9e-03
pancreatic ductal adenocarcinoma liver m... -1.356 8.2e-03
ulcerative colitis 1.100 6.9e-05

PDB (10)

Gene RIF (13)

AA Sequence

MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNE      1 - 70
ASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHL     71 - 140
QKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQ    141 - 210
QQLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEAILQRYRMKGDHLRVYLHYLPSYYHLHVHF    211 - 280
TALGFEAPGSGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLKLLQEAQQS                 281 - 337
//

Text Mined References (36)

PMID Year Title