Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.62
PubTator Score 2.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 2.7e-02
ependymoma 2.700 1.1e-06
lung adenocarcinoma -1.400 5.6e-04
lung carcinoma -2.600 2.9e-08
nasopharyngeal carcinoma -2.700 2.2e-09
non-small cell lung carcinoma -1.500 3.8e-09
osteosarcoma -2.052 3.6e-05

Synonym

Accession Q96C74 D3DTC9 Q9BZX0 ROPN1-like protein
Symbols ASP
RSPH11

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKT      1 - 70
DTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGS     71 - 140
LNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSD    141 - 210
FFFPKRKLLESIENSEDVGH                                                      211 - 230
//

Text Mined References (12)

PMID Year Title