Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
R01 Count 6
Funding $173,092.87
PubMed Score 2.62
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.052 0.000
posterior fossa group B ependymoma 4.500 0.000
lung adenocarcinoma -1.800 0.000
atypical teratoid/rhabdoid tumor 1.100 0.027
nasopharyngeal carcinoma -2.700 0.000
lung carcinoma -2.600 0.000
non-small cell lung carcinoma -1.500 0.000

Gene RIF (2)

PMID Text
25600306 Sp17 and ASP cancer/testis antigens were found in ciliated cells of four ciliated hepatic foregut cysts (CHFCs). Further characterization of Sp17 and ASP in patients with CHFCs may provide significant clues for understanding the molecular mechanisms underlying their predisposition to develop squamous cell carcinomas.
21424380 Single nucleotide polymorphisms in ROPN1L gene is associated with breast cancer.

AA Sequence

MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKT      1 - 70
DTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGS     71 - 140
LNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSD    141 - 210
FFFPKRKLLESIENSEDVGH                                                      211 - 230
//

Text Mined References (12)

PMID Year Title
25600306 2015 Sperm protein 17 and AKAP-associated sperm protein cancer/testis antigens are expressed in ciliated hepatic foregut cysts.
25416956 2014 A proteome-scale map of the human interactome network.
25089627 2014 Long noncoding RNA expression profiles of lung adenocarcinoma ascertained by microarray analysis.
22446040 2012 A novel locus for body mass index on 5p15.2: a meta-analysis of two genome-wide association studies.
21424380 2011 Potential novel candidate polymorphisms identified in genome-wide association study for breast cancer susceptibility.
18421703 2008 Protein kinase A RII-like (R2D2) proteins exhibit differential localization and AKAP interaction.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...