Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
astrocytic glioma 2597 3.2e-02

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.100 3.2e-02

Synonym

Accession Q96C57 Q53HF0 Q9H9Z7
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAAPSGTVSDSESSNSSSDAEELERCREAAMPAWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHE      1 - 70
QDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQ     71 - 140
PRRKRQPSSSSEDSDEEWRRCREAAVSASDILQESAIHSPGTVEKEAKKKRKLKKKAKKVASVDSAVAAT    141 - 210
TPTSMATVQKQKSGELNGDQVSLGTKKKKKAKKASETSPFPPAKSATAIPAN                      211 - 262
//

Text Mined References (22)

PMID Year Title