Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
astrocytic glioma 2,241

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.100 0.032

Gene RIF (1)

PMID Text
19198612 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPSGTVSDSESSNSSSDAEELERCREAAMPAWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHE      1 - 70
QDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQ     71 - 140
PRRKRQPSSSSEDSDEEWRRCREAAVSASDILQESAIHSPGTVEKEAKKKRKLKKKAKKVASVDSAVAAT    141 - 210
TPTSMATVQKQKSGELNGDQVSLGTKKKKKAKKASETSPFPPAKSATAIPAN                      211 - 262
//

Text Mined References (21)

PMID Year Title
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24763700 2014 New variants including ARG1 polymorphisms associated with C-reactive protein levels identified by genome-wide association and pathway analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
21269460 2011 Initial characterization of the human central proteome.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19198612 2009 New susceptibility locus for coronary artery disease on chromosome 3q22.3.
More...