Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytic glioma 2241 0.031893656568009

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.100 0.032

Synonym

Accession Q96C57 Q53HF0 Q9H9Z7
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG

Gene RIF (1)

PMID Text
19198612 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAPSGTVSDSESSNSSSDAEELERCREAAMPAWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHE      1 - 70
QDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQ     71 - 140
PRRKRQPSSSSEDSDEEWRRCREAAVSASDILQESAIHSPGTVEKEAKKKRKLKKKAKKVASVDSAVAAT    141 - 210
TPTSMATVQKQKSGELNGDQVSLGTKKKKKAKKASETSPFPPAKSATAIPAN                      211 - 262
//

Text Mined References (21)

PMID Year Title
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
24763700 2014 New variants including ARG1 polymorphisms associated with C-reactive protein levels identified by genome-wide association and pathway analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
21269460 2011 Initial characterization of the human central proteome.
21203500 2010 Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1? as a master regulator of plasma protein fucosylation.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19198612 2009 New susceptibility locus for coronary artery disease on chromosome 3q22.3.
More...