Property Summary

NCBI Gene PubMed Count 24
PubMed Score 8.16
PubTator Score 4.75

Knowledge Summary

Patent (1,706)

Expression

  Differential Expression (5)

Gene RIF (8)

PMID Text
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with ULK4
24284070 Our findings indicate that ULK4 is a rare susceptibility gene for schizophrenia.
22945773 Single-nucleotide polymorphism rs1052501 in ULK4 gene is associated with monoclonal gammopathy of undetermined significance and multiple myeloma
21045733 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20414254 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19430479 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
12471243 First identified as an ULK family kinase and predicted to be catalytically inactive.

AA Sequence

MENFILYEEIGRGSKTVVYKGRRKGTINFVAILCTDKCKRPEITNWVRLTREIKHKNIVTFHEWYETSNH      1 - 70
LWLVVELCTGGSLKTVIAQDENLPEDVVREFGIDLISGLHHLHKLGILFCDISPRKILLEGPGTLKFSNF     71 - 140
CLAKVEGENLEEFFALVAAEEGGGDNGENVLKKSMKSRVKGSPVYTAPEVVRGADFSISSDLWSLGCLLY    141 - 210
EMFSGKPPFFSESISELTEKILCEDPLPPIPKDSSRPKASSDFINLLDGLLQRDPQKRLTWTRLLQHSFW    211 - 280
KKAFAGADQESSVEDLSLSRNTMECSGPQDSKELLQNSQSRQAKGHKSGQPLGHSFRLENPTEFRPKSTL    281 - 350
EGQLNESMFLLSSRPTPRTSTAVEVSPGEDMTHCSPQKTSPLTKITSGHLSQQDLESQMRELIYTDSDLV    351 - 420
VTPIIDNPKIMKQPPVKFDAKILHLPTYSVDKLLFLKDQDWNDFLQQVCSQIDSTEKSMGASRAKLNLLC    421 - 490
YLCVVAGHQEVATRLLHSPLFQLLIQHLRIAPNWDIRAKVAHVIGLLASHTAELQENTPVVEAIVLLTEL    491 - 560
IRENFRNSKLKQCLLPTLGELIYLVATQEEKKKNPRECWAVPLAAYTVLMRCLREGEERVVNHMAAKIIE    561 - 630
NVCTTFSAQSQGFITGEIGPILWYLFRHSTADSLRITAVSALCRITRHSPTAFQNVIEKVGLNSVINSLA    631 - 700
SAICKVQQYMLTLFAAMLSCGIHLQRLIQEKGFVSTIIRLLDSPSTCIRAKAFLVLLYILIYNREMLLLS    701 - 770
CQARLVMYIERDSRKTTPGKEQQSGNEYLSKCLDLLICHIVQELPRILGDILNSLANVSGRKHPSTVQVK    771 - 840
QLKLCLPLMPVVLHLVTSQVFRPQVVTEEFLFSYGTILSHIKSVDSGETNIDGAIGLTASEEFIKITLSA    841 - 910
FEAIIQYPILLKDYRSTVVDYILPPLVSLVQSQNVEWRLFSLRLLSETTSLLVNQEFGDGKEKASVDSDS    911 - 980
NLLALIRDVLLPQYEHILLEPDPVPAYALKLLVAMTEHNPTFTRLVEESKLIPLIFEVTLEHQESILGNT    981 - 1050
MQSVIALLSNLVACKDSNMELLYEQGLVSHICNLLTETATLCLDVDNKNNNEMAAPLLFSLLDILHSMLT   1051 - 1120
YTSGIVRLALQAQKSGSGEDPQAAEDLLLLNRPLTDLISLLIPLLPNEDPEIFDVSSKCLSILVQLYGGE   1121 - 1190
NPDSLSPENVEIFAHLLTSKEDPKEQKLLLRILRRMITSNEKHLESLKNAGSLLRALERLAPGSGSFADS   1191 - 1260
AVAPLALEILQAVGH                                                          1261 - 1275
//

Text Mined References (28)

PMID Year Title
27300315 2016 Ulk4 Regulates Neural Stem Cell Pool.
26956052 2016 Survival kinase genes present prognostic significance in glioblastoma.
26208877 2015 Cross-cancer profiling of molecular alterations within the human autophagy interaction network.
25519392 2014 Haplotype approach for association analysis on hypertension.
25519342 2014 Bivariate genetic association analysis of systolic and diastolic blood pressure by copula models.
25249183 2015 Genome-wide association study in Chinese identifies novel loci for blood pressure and hypertension.
24944762 2014 Elevated blood pressure: Our family's fault? The genetics of essential hypertension.
24284070 2014 Recurrent deletions of ULK4 in schizophrenia: a gene crucial for neuritogenesis and neuronal motility.
23972371 2013 Genome-wide association analysis of blood-pressure traits in African-ancestry individuals reveals common associated genes in African and non-African populations.
23502783 2013 The CCND1 c.870G>A polymorphism is a risk factor for t(11;14)(q13;q32) multiple myeloma.
More...