Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.73
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.100 5.0e-03
ependymoma 1.100 1.8e-06
medulloblastoma, large-cell 1.300 1.2e-04
osteosarcoma -1.514 5.6e-05
tuberculosis and treatment for 6 months -1.100 7.3e-05

Protein-protein Interaction (8)

Gene RIF (4)

AA Sequence

MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV      1 - 70
KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH     71 - 140
ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL    141 - 210
LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA    211 - 280
ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD                                  281 - 320
//

Text Mined References (23)

PMID Year Title