Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.62
PubTator Score 3.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.514 0.000
posterior fossa group B ependymoma 1.300 0.000
medulloblastoma, large-cell 1.300 0.000
tuberculosis and treatment for 6 months -1.100 0.000
breast carcinoma 1.100 0.005

Synonym

Accession Q96C36 A8K798 Q7Z515 Q9Y5J4 P5C reductase 2
Symbols HLD10
P5CR2

Gene

Gene RIF (1)

PMID Text
25865492 Hypomyelination and the absence of lax caused by previously reported mutations in the gene encoding PYCR2's isozyme, PYCR1, suggesting a unique and indispensable role for PYCR2 in the human CNS during development.

AA Sequence

MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV      1 - 70
KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH     71 - 140
ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL    141 - 210
LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA    211 - 280
ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD                                  281 - 320
//

Text Mined References (20)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25865492 2015 Mutations in PYCR2, Encoding Pyrroline-5-Carboxylate Reductase 2, Cause Microcephaly and Hypomyelination.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23024808 2012 Functional specialization in proline biosynthesis of melanoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...