Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.25
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDMAQEPVTFRDVAIYFSREEWACLEPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVED      1 - 70
RERPEFQAVQRGPRPGARKSADPKRPCDHPAWAHKKTHVRRERAREGSSFRKGFRLDTDDGQLPRAAPER     71 - 140
TDAKPTAFPCQVLTQRCGRRPGRRERRKQRAVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECG    141 - 210
QTFRWASNLQRHQKNHTREKPFCCEACGQAFSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKSNLLRHQL    211 - 280
VHTGERPFYCADCGKAFRTKENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSIHRRLHLTKRFYECGHCG    281 - 350
KGFRHLGFFTRHQRTHRHGEV                                                     351 - 371
//

Text Mined References (11)

PMID Year Title