Property Summary

NCBI Gene PubMed Count 28
PubMed Score 18.70
PubTator Score 9.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytoma 2.400 1.2e-16
Astrocytoma, Pilocytic 2.000 3.5e-05
atypical teratoid / rhabdoid tumor -1.100 1.6e-02
glioblastoma 1.400 7.0e-03
group 3 medulloblastoma 1.100 2.7e-02
intraductal papillary-mucinous adenoma (... 1.600 9.2e-04
intraductal papillary-mucinous carcinoma... 1.700 5.0e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.8e-02
medulloblastoma, large-cell -1.100 1.5e-02
nasopharyngeal carcinoma -1.200 2.1e-03
oligodendroglioma 1.700 4.6e-02
osteosarcoma -3.187 4.5e-06
ovarian cancer -2.200 1.3e-09
pancreatic cancer 1.200 2.4e-03
pancreatic carcinoma 1.200 2.4e-03
pancreatic ductal adenocarcinoma liver m... -1.781 1.1e-02
pediatric high grade glioma 1.100 3.9e-02
Pick disease 1.600 2.9e-02
spina bifida -2.347 1.7e-02

Gene RIF (9)

AA Sequence

MSELLDLSFLSEEEKDLILSVLQRDEEVRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRTCARCQESL      1 - 70
GRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFYDQKVNRFAYRTGSEIIRMSL     71 - 140
RHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQKEPSVLFEVPKLKSGKSALEAESESLDSFTADSD    141 - 210
STSRRDSLDKSGLFPEWKKMSAPKSQVEKETQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRP    211 - 280
EDVVHESGSLGDRSKSVPGLNVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGD    281 - 350
FGNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTI    351 - 420
NPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPT    421 - 490
GLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRN    491 - 560
KASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVV    561 - 630
DWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL                                 631 - 671
//

Text Mined References (33)

PMID Year Title