Property Summary

NCBI Gene PubMed Count 26
Grant Count 1
Funding $65,926.4
PubMed Score 18.45
PubTator Score 9.61

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96C24 Q5H9J3 Q5JPG8 Q8N9P4 Q9H4R0 Q9H4R1
Symbols SLP4

Gene

 Grant Application (1)

PDB

2CSZ   3FDW  

Gene RIF (7)

PMID Text
26553929 GLUT5 required an interaction cascade of Rab11, Myo5B, Slp4a, Munc18-2, and Vamp7 with Stx3.
25595293 Phosphatidylinositol 4,5-bisphosphate binds to the concave surface of granuphilin-C2A domain. The key residues involved in the binding were validated by mutation analysis.
24700782 Recruitment of STXBP1 by the Rab27A effector SYTL4 promotes Weibel-Palade body exocytosis.
24184645 the mechanisms of granuphilin plasma membrane targeting and release
23140275 Slp4 and Rab8 are expressed and interact in human platelets, and might be involved in dense granule release.
16831872 in insulin-producing cells adequate levels of mir-9 are mandatory for maintaining appropriate Granuphilin levels and optimal secretory capacity
11773082 Synaptotagmin-like protein 4 (Slp4)/granuphilin-a contains an N-terminal Slp homology domain (SHD) (PMID: 11327731). The SHD of Slp4 specifically and directly binds the GTP-bound form of Rab3A, Rab8, and Rab27A.

AA Sequence

MSELLDLSFLSEEEKDLILSVLQRDEEVRKADEKRIRRLKNELLEIKRKGAKRGSQHYSDRTCARCQESL      1 - 70
GRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFYDQKVNRFAYRTGSEIIRMSL     71 - 140
RHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQKEPSVLFEVPKLKSGKSALEAESESLDSFTADSD    141 - 210
STSRRDSLDKSGLFPEWKKMSAPKSQVEKETQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRP    211 - 280
EDVVHESGSLGDRSKSVPGLNVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGD    281 - 350
FGNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTI    351 - 420
NPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPT    421 - 490
GLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRN    491 - 560
KASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVV    561 - 630
DWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL                                 631 - 671
//

Text Mined References (31)

PMID Year Title
26553929 2015 Cargo-selective apical exocytosis in epithelial cells is conducted by Myo5B, Slp4a, Vamp7, and Syntaxin 3.
25595293 2015 Insights into the molecular recognition of the granuphilin C2A domain with PI(4,5)P2.
25416956 2014 A proteome-scale map of the human interactome network.
24700782 2014 STXBP1 promotes Weibel-Palade body exocytosis through its interaction with the Rab27A effector Slp4-a.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24184645 2014 The C2 domains of granuphilin are high-affinity sensors for plasma membrane lipids.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23140275 2013 Synaptotagmin-like protein 4 and Rab8 interact and increase dense granule release in platelets.
19966785 2010 Rab27a and Rab27b control different steps of the exosome secretion pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...