Property Summary

NCBI Gene PubMed Count 19
Grant Count 6
R01 Count 6
Funding $270,071.79
PubMed Score 21.65
PubTator Score 26.58

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25383639 EFhd2 is involved in the control of synapse development and maintenance and is linked to dementia.
24917152 The results imply that EFhd2's physiological and/or pathological function could be regulated by its phosphorylation state.
23977092 Swiprosin-1 localizes to microvilli-like membrane protrusions and lamellipodia and exhibits actin-binding activity.
23959172 Swiprosin-1 is involved in regulating the accessibility of F-actin to cofilin through the clustering of F-actin and the activity of Swiprosin-1 is highly dependent on its phosphorylation status at Ser183
23331044 EFhd2 may play an important role in the pathobiology of tau-mediated neurodegeneration.
21965664 the human Shu complex (hSWS1.SWSAP1) has an evolutionarily conserved function in homologous recombination
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
19693767 These results suggest that swiprosin-1 is a PKC-beta I/eta-inducible gene and it modulates mast cell activation through NF-kappaB-dependent pathway.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
15274114 Its predominant presence in CD8 lymphocytes suggests that swiprosin-1 may be involved in functions that are important for cytotoxic lymphocytes.

AA Sequence

MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIG      1 - 70
EPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEV     71 - 140
DEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEE    141 - 210
IKAEQEERKKQAEEMKQRKAAFKELQSTFK                                            211 - 240
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25383639 2014 The calcium-binding protein EFhd2 modulates synapse formation in vitro and is linked to human dementia.
24917152 2014 Cdk5 phosphorylation of EFhd2 at S74 affects its calcium binding activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23977092 2013 Swiprosin-1 is a novel actin bundling protein that regulates cell spreading and migration.
23959172 2013 Swiprosin-1 modulates actin dynamics by regulating the F-actin accessibility to cofilin.
23331044 2013 EFhd2 is a novel amyloid protein associated with pathological tau in Alzheimer's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...