Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.91
PubTator Score 26.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (11)

AA Sequence

MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIG      1 - 70
EPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEV     71 - 140
DEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEE    141 - 210
IKAEQEERKKQAEEMKQRKAAFKELQSTFK                                            211 - 240
//

Text Mined References (33)

PMID Year Title