Property Summary

NCBI Gene PubMed Count 16
PubMed Score 9.48
PubTator Score 6.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (11)

PMID Text
24439956 Single-nucleotide polymorphism in FGGY is not associated with amyotrophic lateral sclerosis in a large Chinese cohort.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20001489 This study indicated that mutations in fggy genes are unlikely to be a common cause of ALS in the French and French Canadian populations.
20001489 Observational study of gene-disease association. (HuGE Navigator)
19922138 Results suggest that common genetic variation in FGGY is not associated with susceptibility to sporadic ALS in genetically homogeneous populations from northern Europe.
19922138 Observational study of gene-disease association. (HuGE Navigator)
19922123 Observational study of gene-disease association. (HuGE Navigator)
19464757 The result of this study suggested that FLJI0986 that do not modulate the risk for SALS in the German population.
19193627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17671248 Genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSGGEQKPERYYVGVDVGTGSVRAALVDQSGVLLAFADQPIKNWEPQFNHHEQSSEDIWAACCVVTKKVV      1 - 70
QGIDLNQIRGLGFDATCSLVVLDKQFHPLPVNQEGDSHRNVIMWLDHRAVSQVNRINETKHSVLQYVGGV     71 - 140
MSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMI    141 - 210
GLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLIC    211 - 280
EGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPE    281 - 350
LQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDL    351 - 420
AILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAA    421 - 490
VLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD             491 - 551
//

Text Mined References (18)

PMID Year Title
24439956 2014 Single-nucleotide polymorphism rs6690993 in FGGY is not associated with amyotrophic lateral sclerosisin a large Chinese cohort.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22215998 2011 The FGGY carbohydrate kinase family: insights into the evolution of functional specificities.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20001489 2010 Analysis of DPP6 and FGGY as candidate genes for amyotrophic lateral sclerosis.
19922138 Analysis of FGGY as a risk factor for sporadic amyotrophic lateral sclerosis.
19922123 Clinical and genetic features of patients with sporadic amyotrophic lateral sclerosis in south-west China.
19875103 2010 Genomewide association study of movement-related adverse antipsychotic effects.
More...