Property Summary

NCBI Gene PubMed Count 30
Grant Count 34
R01 Count 18
Funding $3,605,751.12
PubMed Score 40.59
PubTator Score 45.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.001
medulloblastoma, large-cell -1.100 0.000
Multiple Sclerosis 2.100 0.009

Gene RIF (20)

PMID Text
25794939 This review briefly summarizes the RLR system, and focuses on the relationship between LGP2 and MDA5, describing in detail how these two proteins work together to detect foreign RNA and generate a fully functional antiviral response.
25288302 LGP2 did not reveal significant single-SNP associations with multiple sclerosis risk.
25127512 LGP2 increases the initial rate of MDA5-RNA interaction and regulates MDA5 filament assembly.
24829334 Experiments with paramyxovirus V protein-insensitive proteins revealed that the primary outcome of LGP2 interference is suppression of its ability to synergize with MDA5.
24550253 L region antisense RNA of EMCV is a key determinant of innate immunity to the virus and represents an RNA that activates LGP2 associated MDA5 in virally-infected cells.
23671710 Data show that LGP2 is able to synergize with melanoma differentiation associated gene-5 (mda-5) to render cells to induction by poly(I:C), but did not enhance retinoic acid-inducible gene-I (RIG-I) to induce type I interferon in response to poly(I:C).
23184951 results demonstrate previously unrecognized properties of LGP2 ATP hydrolysis and RNA interaction and provide a mechanistic basis for a positive regulatory role for LGP2 in antiviral signaling
22837208 LGP2, a host protein induced during influenza A virus infection, downregulates the host antiviral IFN response
22301134 Paramyxovirus 5 V proteins interact with the RNA Helicase LGP2 to inhibit RIG-I-dependent interferon beta induction.
22185736 the present study shows the presence of RIG-1,MDA-5, and LGP-2 in the human upper airways, most prominently inthe epithelium.
More...

AA Sequence

MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRM      1 - 70
LDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDT     71 - 140
VYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEH    141 - 210
SQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVY    211 - 280
ALHLRRYNDALLIHDTVRAVDALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPK    281 - 350
LEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ    351 - 420
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSREL    421 - 490
KRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCM    491 - 560
VAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKL    561 - 630
PVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD                          631 - 678
//

Text Mined References (39)

PMID Year Title
25794939 2015 LGP2 synergy with MDA5 in RLR-mediated RNA recognition and antiviral signaling.
25340845 2014 A novel function of human Pumilio proteins in cytoplasmic sensing of viral infection.
25288302 2014 Analysis of polymorphisms in RIG-I-like receptor genes in German multiple sclerosis patients.
25127512 2014 The innate immune sensor LGP2 activates antiviral signaling by regulating MDA5-RNA interaction and filament assembly.
24829334 2014 Paramyxovirus V protein interaction with the antiviral sensor LGP2 disrupts MDA5 signaling enhancement but is not relevant to LGP2-mediated RLR signaling inhibition.
24550253 2014 Identification of an LGP2-associated MDA5 agonist in picornavirus-infected cells.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23671710 2013 LGP2 plays a critical role in sensitizing mda-5 to activation by double-stranded RNA.
23184951 2013 ATP hydrolysis enhances RNA recognition and antiviral signal transduction by the innate immune sensor, laboratory of genetics and physiology 2 (LGP2).
22837208 2012 LGP2 downregulates interferon production during infection with seasonal human influenza A viruses that activate interferon regulatory factor 3.
More...