Property Summary

NCBI Gene PubMed Count 33
PubMed Score 45.87
PubTator Score 45.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 3.3e-05
psoriasis 6694 1.3e-03
Multiple Sclerosis 540 9.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Melanoma 711 4.37 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 3.3e-05
Multiple Sclerosis 2.100 9.2e-03
psoriasis 1.400 1.3e-03

 GWAS Trait (1)

Gene RIF (23)

AA Sequence

MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRM      1 - 70
LDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDT     71 - 140
VYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSPQNCCPQLQEH    141 - 210
SQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVY    211 - 280
ALHLRRYNDALLIHDTVRAVDALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPK    281 - 350
LEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ    351 - 420
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSREL    421 - 490
KRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVEHVQLLCINCM    491 - 560
VAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKL    561 - 630
PVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD                          631 - 678
//

Text Mined References (43)

PMID Year Title