Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.76
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.1e-04
spina bifida 1074 4.1e-02
Disease Target Count Z-score Confidence
Optic Atrophy 242 3.584 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.545 7.1e-04
spina bifida -1.897 4.1e-02

Gene RIF (10)

AA Sequence

MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKE      1 - 70
LSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVT     71 - 140
IPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLV    141 - 210
PGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIR    211 - 280
PSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDA    281 - 350
GTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCH    351 - 420
FNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL                                        421 - 454
//

Text Mined References (21)

PMID Year Title