Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $226,270.69
PubMed Score 4.42
PubTator Score 4.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.545 0.001
spina bifida -1.897 0.041

Synonym

Accession Q96C03 J3KPT3 Q6ZRD4 Q96N07
Symbols MID49
SMCR7

Gene

Gene RIF (7)

PMID Text
26903540 The results indicate that Drp1-dependent mitochondrial fission through MiD49/MiD51 regulates cristae remodeling during intrinsic apoptosis.
23921378 MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and suggest that they provide specificity to the division of mitochondria.
23880462 MIEF1 and MIEF2 are differentially expressed in human tissues during development
23283981 we find that either MiD49 or MiD51 can mediate Drp1 recruitment and mitochondrial fission in the absence of Fis1 and Mff.
21508961 MiD49/51 are new mediators of mitochondrial division affecting Drp1 action at mitochondria.
21508961 Mitochondrial outer membrane protein that recruits fission mediator Drp1 to the mitochondrial surface.
15517828 Smith-Magenis syndrome is caused by a de novo deletion on chromosome 17.

AA Sequence

MAEFSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDRATSPRDEDDTKADSWKE      1 - 70
LSLLKATPHLQPRPPPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVT     71 - 140
IPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLLVPLVLEPGLWSLV    141 - 210
PGVDTVARDPRCWAVRRTQLEFCPRGSSPWDRFLVGGYLSSRVLLELLRKALAASVNWPAIGSLLGCLIR    211 - 280
PSMASEELLLEVQHERLELTVAVLVAVPGVDADDRLLLAWPLEGLAGNLWLQDLYPVEAARLRALDDHDA    281 - 350
GTRRRLLLLLCAVCRGCSALGQLGRGHLTQVVLRLGEDNVDWTEEALGERFLQALELLIGSLEQASLPCH    351 - 420
FNPSVNLFSSLREEEIDDIGYALYSGLQEPEGLL                                        421 - 454
//

Text Mined References (18)

PMID Year Title
26903540 2016 Drp1-dependent mitochondrial fission via MiD49/51 is essential for apoptotic cristae remodeling.
25416956 2014 A proteome-scale map of the human interactome network.
23921378 2013 Adaptor proteins MiD49 and MiD51 can act independently of Mff and Fis1 in Drp1 recruitment and are specific for mitochondrial fission.
23880462 2013 The mitochondrial elongation factors MIEF1 and MIEF2 exert partially distinct functions in mitochondrial dynamics.
23530241 2013 Interchangeable adaptors regulate mitochondrial dynamin assembly for membrane scission.
23283981 2013 Fis1, Mff, MiD49, and MiD51 mediate Drp1 recruitment in mitochondrial fission.
21508961 2011 MiD49 and MiD51, new components of the mitochondrial fission machinery.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...