Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.77
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.200 8.9e-04
lung cancer 2.700 5.4e-04

Synonym

Accession Q96C01 Q96SS3
Symbols

Gene

  Ortholog (1)

Species Source Disease
Rat EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTS      1 - 70
ELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK       71 - 138
//

Text Mined References (21)

PMID Year Title