Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.77
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Meniere Disease 2
Disease Target Count P-value
lung cancer 4473 5.36205122818758E-4
breast carcinoma 1614 8.88234160254402E-4
Disease Target Count Z-score Confidence
Motion sickness 32 3.667 1.8
Sensorineural hearing loss 107 3.094 1.5
Disease Target Count
Meniere's disease 25

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 2.700 0.001
breast carcinoma 1.200 0.001

Synonym

Accession Q96C01 Q96SS3
Symbols

Gene

  Ortholog (3)

Species Source
Rat EggNOG Inparanoid
Horse EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (2)

PMID Text
25305078 our findings suggest that novel mutations in FAM136A and DTNA genes are probably causal variants in FMD.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAELQQLRVQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTS      1 - 70
ELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK       71 - 138
//

Text Mined References (21)

PMID Year Title
27083884 2016 Genetics of vestibular disorders: pathophysiological insights.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25305078 2015 Identification of two novel mutations in FAM136A and DTNA genes in autosomal-dominant familial Meniere's disease.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...