Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.82
PubTator Score 4.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.301 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell -1.200 0.000
ovarian cancer 1.800 0.000

Synonym

Accession Q96BZ9 A8K6I3 B9A6M1 Q5JWQ7 Q6ZSY8 Q96NE1 Q9BYM7 Q9H140
Symbols WARBM4
C20orf140

Gene

PDB

4HLQ   4HL4  

Gene RIF (13)

PMID Text
26063829 Warburg Micro syndrome is caused by TBC1D20 deficiency.
24239381 Loss-of-function mutations in TBC1D20 cause cataracts and male infertility in blind sterile mice and Warburg micro syndrome in humans.
23236136 The detailed molecular reaction mechanism of a complex between human Rab and RabGAP at the highest possible spatiotemporal resolution and in atomic detail, is described.
22491470 The NS5A interaction with TBC1D20 and Rab1 is essential for the viral life cycle.
22260459 These findings add TBC1D20 to the network of host factors regulating HIV replication cycle.
22260459 Overexpression of TBC1D20 induces relocalization of HIV-1 Env from detergent-resistant membrane compartments to soluble compartments
22260459 Overexpression of TBC1D20 induces relocalization of HIV-1 Env from detergent-resistant membrane compartments to soluble compartments
22260459 Overexpression of TBC1D20 induces relocalization of HIV-1 Env from detergent-resistant membrane compartments to soluble compartments
22260459 Overexpression of TBC1D20 induces relocalization of HIV-1 Env from detergent-resistant membrane compartments to soluble compartments
22260459 Overexpression of TBC1D20 induces relocalization of HIV-1 Env from detergent-resistant membrane compartments to soluble compartments
More...

AA Sequence

MALRSAQGDGPTSGHWDGGAEKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVW      1 - 70
PKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQL     71 - 140
HYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSA    141 - 210
EVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLS    211 - 280
QIPQDLPYETLISRAGDLFVQFPPSELAREAAAQQQAERTAASTFKDFELASAQQRPDMVLRQRFRGLLR    281 - 350
PEDRTKDVLTKPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP                     351 - 403
//

Text Mined References (18)

PMID Year Title
26063829 2015 Warburg Micro syndrome is caused by RAB18 deficiency or dysregulation.
24239381 2013 Loss-of-function mutations in TBC1D20 cause cataracts and male infertility in blind sterile mice and Warburg micro syndrome in humans.
23236136 2012 Catalytic mechanism of a mammalian Rab·RabGAP complex in atomic detail.
22854043 2012 Functional involvement of Rab1A in microtubule-dependent anterograde melanosome transport in melanocytes.
22491470 2012 Role for TBC1D20 and Rab1 in hepatitis C virus replication via interaction with lipid droplet-bound nonstructural protein 5A.
22260459 2012 Human immunodeficiency virus type 1 envelope proteins traffic toward virion assembly sites via a TBC1D20/Rab1-regulated pathway.
21680502 2011 Analysis of Rab GTPase-activating proteins indicates that Rab1a/b and Rab43 are important for herpes simplex virus 1 secondary envelopment.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
17901050 2007 TBC1D20 is a Rab1 GTPase-activating protein that mediates hepatitis C virus replication.
17686842 2007 A Rab-GAP TBC domain protein binds hepatitis C virus NS5A and mediates viral replication.
More...