Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.81
PubTator Score 4.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Warburg Sjo Fledelius syndrome 4 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 1.4e-07
glioblastoma 5792 5.1e-06
ovarian cancer 8520 2.6e-05
medulloblastoma, large-cell 6241 1.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Microcephaly 166 3.267 1.6
Microphthalmia 76 3.113 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.300 5.1e-06
medulloblastoma, large-cell -1.200 1.3e-04
osteosarcoma -2.301 1.4e-07
ovarian cancer 1.800 2.6e-05

Gene RIF (7)

AA Sequence

MALRSAQGDGPTSGHWDGGAEKADFNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVW      1 - 70
PKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQL     71 - 140
HYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSA    141 - 210
EVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLS    211 - 280
QIPQDLPYETLISRAGDLFVQFPPSELAREAAAQQQAERTAASTFKDFELASAQQRPDMVLRQRFRGLLR    281 - 350
PEDRTKDVLTKPRTNRFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP                     351 - 403
//

Text Mined References (18)

PMID Year Title