Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.57
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 8.73504055347061E-5
pilocytic astrocytoma 3086 1.31635326803206E-4
mucosa-associated lymphoid tissue lymphoma 480 0.0064478865626482
osteosarcoma 7933 0.0110021660325477
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -1.500 0.044
osteosarcoma -1.352 0.011
medulloblastoma, large-cell -1.200 0.000
pilocytic astrocytoma 1.200 0.000
mucosa-associated lymphoid tissue lympho... -1.263 0.006

Synonym

Accession Q96BZ4 Q6UWD2 PLD 4
Symbols C14orf175

Gene

  Ortholog (11)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
23124809 We determined that PLD4 is a novel susceptibility gene for sysetmic sclerosis in Japanese, thus confirming the involvement of PLD4 in autoimmunity.

AA Sequence

MLKPLWKAAVAPTWPCSMPPRRPWDREAGTLQVLGALAVLWLGSVALICLLWQVPRPPTWGQVQPKDVPR      1 - 70
SWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQAWLQLLDTAQESVHVASYYW     71 - 140
SLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSSPTLARTSTDLQVLAARGAHVRQVPMGRLTR    141 - 210
GVLHSKFWVVDGRHIYMGSANMDWRSLTQVKELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQ    211 - 280
NFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSH    281 - 350
PPRYWPVLDNALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSN    351 - 420
IPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQLFERDWSSRYA    421 - 490
VGLDGQAPGQDCVWQG                                                          491 - 506
//

Text Mined References (7)

PMID Year Title
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23124809 2013 PLD4 as a novel susceptibility gene for systemic sclerosis in a Japanese population.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.