Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.56
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid arthritis -1.500 4.4e-02
Astrocytoma, Pilocytic 1.200 1.5e-04
medulloblastoma, large-cell -1.200 8.7e-05
mucosa-associated lymphoid tissue lympho... -1.263 6.4e-03
osteosarcoma -1.352 1.1e-02

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MLKPLWKAAVAPTWPCSMPPRRPWDREAGTLQVLGALAVLWLGSVALICLLWQVPRPPTWGQVQPKDVPR      1 - 70
SWEHGSSPAWEPLEAEARQQRDSCQLVLVESIPQDLPSAAGSPSAQPLGQAWLQLLDTAQESVHVASYYW     71 - 140
SLTGPDIGVNDSSSQLGEALLQKLQQLLGRNISLAVATSSPTLARTSTDLQVLAARGAHVRQVPMGRLTR    141 - 210
GVLHSKFWVVDGRHIYMGSANMDWRSLTQVKELGAVIYNCSHLAQDLEKTFQTYWVLGVPKAVLPKTWPQ    211 - 280
NFSSHFNRFQPFHGLFDGVPTTAYFSASPPALCPQGRTRDLEALLAVMGSAQEFIYASVMEYFPTTRFSH    281 - 350
PPRYWPVLDNALRAAAFGKGVRVRLLVGCGLNTDPTMFPYLRSLQALSNPAANVSVDVKVFIVPVGNHSN    351 - 420
IPFSRVNHSKFMVTEKAAYIGTSNWSEDYFSSTAGVGLVVTQSPGAQPAGATVQEQLRQLFERDWSSRYA    421 - 490
VGLDGQAPGQDCVWQG                                                          491 - 506
//

Text Mined References (8)

PMID Year Title