Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.97
PubTator Score 7.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.002
ovarian cancer -2.400 0.000
dermatomyositis 1.300 0.001

Synonym

Accession Q96BY9 B3KQQ4 B7Z9J1 D3DSU7 H9MHJ8 H9MHJ9 Q53HE8 Q9UNZ3 Q9Y683 SARAF
Symbols XTP3
FOAP-7
TMEM66
HSPC035

Gene

Gene RIF (6)

PMID Text
26817842 SARAF is constitutively expressed in the plasma membrane and interacts with Orai1.
23816623 Deletion of STIM1(448-490) and, in particular, STIM1(447-460) and STIM1(475-490) markedly enhances interaction of SARAF with STIM1.
23049731 Store-operated Ca2+ entry is remodelled and controls in vitro angiogenesis in endothelial progenitor cells isolated from tumoral patients.
22464749 Study shows that SARAF is an endoplasmic reticulum resident protein, which responds to cytosolic Ca2+ elevation after ER Ca2+ refilling by promoting a slow inactivation process of STIM2-dependent basal SOCE activity, as well as STIM1-mediated SOCE activity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of transmembrane protein 66 (TMEM66) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MAAACGPGAAGYCLLLGLHLFLLTAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGT      1 - 70
AGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTE     71 - 140
LGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLLGIAFVVYKLFLSDGQYSPPPYSEYPPF    141 - 210
SHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSN    211 - 280
RAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR               281 - 339
//

Text Mined References (15)

PMID Year Title
26817842 2016 Store-operated Ca2+ Entry-associated Regulatory factor (SARAF) Plays an Important Role in the Regulation of Arachidonate-regulated Ca2+ (ARC) Channels.
23816623 2013 The STIM1 CTID domain determines access of SARAF to SOAR to regulate Orai1 channel function.
23049731 2012 Store-operated Ca2+ entry is remodelled and controls in vitro angiogenesis in endothelial progenitor cells isolated from tumoral patients.
22464749 2012 SARAF inactivates the store operated calcium entry machinery to prevent excess calcium refilling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...