Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.85
PubTator Score 7.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.3e-06
dermatomyositis 966 1.4e-03
medulloblastoma, large-cell 6241 2.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
dermatomyositis 1.300 1.4e-03
medulloblastoma, large-cell -1.100 2.3e-03
ovarian cancer -2.400 2.3e-06

Gene RIF (9)

AA Sequence

MAAACGPGAAGYCLLLGLHLFLLTAGPALGWNDPDRMLLRDVKALTLHYDRYTTSRRLDPIPQLKCVGGT      1 - 70
AGCDSYTPKVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLEYNLDYTE     71 - 140
LGLQKLKESGKQHGFASFSDYYYKWSSADSCNMSGLITIVVLLGIAFVVYKLFLSDGQYSPPPYSEYPPF    141 - 210
SHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSN    211 - 280
RAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR               281 - 339
//

Text Mined References (18)

PMID Year Title