Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.49
PubTator Score 6.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
pilocytic astrocytoma 3086 2.29270840956023E-7
group 4 medulloblastoma 1875 3.30133639238776E-7
ovarian cancer 8492 1.86363170032132E-6
primary Sjogren syndrome 789 3.08879843205335E-5
medulloblastoma, large-cell 6234 3.10076712123434E-5
lung cancer 4473 3.42889266265354E-4
Down syndrome 548 5.26810616308632E-4
invasive ductal carcinoma 2950 5.48438111117332E-4
cystic fibrosis 1670 6.14777551454835E-4
glioblastoma 5572 0.00135742348967982
Pick disease 1893 0.0018545647721864
ulcerative colitis 2087 0.0033053034805099
cutaneous lupus erythematosus 1056 0.00339002998918937
interstitial cystitis 2299 0.00360660453165457
psoriasis 6685 0.0044567498232904
aldosterone-producing adenoma 664 0.00745902276209637
progressive supranuclear palsy 674 0.0121785769224023
ductal carcinoma in situ 1745 0.0231818080430423
subependymal giant cell astrocytoma 2287 0.0344227042156815
chronic lymphocytic leukemia 244 0.0357513313102099
osteosarcoma 7933 0.0428085370660478
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (21)

Disease log2 FC p
chronic lymphocytic leukemia 1.022 0.036
cutaneous lupus erythematosus 1.800 0.003
psoriasis -1.200 0.004
osteosarcoma -1.120 0.043
glioblastoma 1.100 0.001
group 4 medulloblastoma -3.000 0.000
cystic fibrosis 1.255 0.001
medulloblastoma, large-cell -2.700 0.000
lung cancer -2.600 0.000
interstitial cystitis 2.000 0.004
pilocytic astrocytoma 1.900 0.000
primary Sjogren syndrome 2.500 0.000
aldosterone-producing adenoma -1.817 0.007
subependymal giant cell astrocytoma 1.241 0.034
invasive ductal carcinoma 1.132 0.001
Pick disease -1.300 0.002
progressive supranuclear palsy -1.800 0.012
ductal carcinoma in situ 1.200 0.023
ulcerative colitis 1.300 0.003
ovarian cancer -1.800 0.000
Down syndrome 1.200 0.001

Synonym

Accession Q96BY6 B3FL70 O75178 Q9NW06 Q9NXI8
Symbols ZIZ3
DRIP2
Nbla10300

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA EggNOG

Gene RIF (4)

PMID Text
21514340 T cells and B cells exhibited inverse expression patterns of the DOCK10 isoforms
18854154 Knockdown of dedicator of cytokinesis 10 (DOCK10) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18835169 Silencing DOCK10 expression in melanoma promotes conversion to mesenchymal migration and is associated with decreased MLC2 phosphorylation and increased Rac1 activation.
18499258 Dock10 could represent a point of convergence for interleukin 4 signalling and small Rho GTPase function in B cells.

AA Sequence

MAGERTRRFTRSLLRPGQAAELRHSAASAAAVAVSSRQQQRQEKPRLLEPLDYETVIEELEKTYRNDPLQ      1 - 70
DLLFFPSDDFSAATVSWDIRTLYSTVPEDAEHKAENLLVKEACKFYSSQWHVVNYKYEQYSGDIRQLPRA     71 - 140
EYKPEKLPSHSFEIDHEDADKDEDTTSHSSSKGGGGAGGTGVFKSGWLYKGNFNSTVNNTVTVRSFKKRY    141 - 210
FQLTQLPDNSYIMNFYKDEKISKEPKGCIFLDSCTGVVQNNRLRKYAFELKMNDLTYFVLAAETESDMDE    211 - 280
WIHTLNRILQISPEGPLQGRRSTELTDLGLDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKT    281 - 350
TRNMERLNLFSLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSNLQGCVTENENDPITNI    351 - 420
EPFFVSVALYDLRDSRKISADFHVDLNHAAVRQMLLGASVALENGNIDTITPRQSEEPHIKGLPEEWLKF    421 - 490
PKQAVFSVSNPHSEIVLVAKIEKVLMGNIASGAEPYIKNPDSNKYAQKILKSNRQFCSKLGKYRMPFAWA    491 - 560
VRSVFKDNQGNVDRDSRFSPLFRQESSKISTEDLVKLVSDYRRADRISKMQTIPGSLDIAVDNVPLEHPN    561 - 630
CVTSSFIPVKPFNMMAQTEPTVEVEEFVYDSTKYCRPYRVYKNQIYIYPKHLKYDSQKCFNKARNITVCI    631 - 700
EFKNSDEESAKPLKCIYGKPGGPLFTSAAYTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCD    701 - 770
INAKANAKKKEALETSVGYAWLPLMKHDQIASQEYNIPIATSLPPNYLSFQDSASGKHGGSDIKWVDGGK    771 - 840
PLFKVSTFVVSTVNTQDPHVNAFFQECQKREKDMSQSPTSNFIRSCKNLLNVEKIHAIMSFLPIILNQLF    841 - 910
KVLVQNEEDEITTTVTRVLTDIVAKCHEEQLDHSVQSYIKFVFKTRACKERTVHEELAKNVTGLLKSNDS    911 - 980
TTVKHVLKHSWFFFAIILKSMAQHLIDTNKIQLPRPQRFPESYQNELDNLVMVLSDHVIWKYKDALEETR    981 - 1050
RANHSVARFLKRCFTFMDRGYVFKMVNNYISMFSSGDLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANI   1051 - 1120
PDPLTPSESTQELHASDMPEYSVTNEFCRKHFLIGILLREVGFALQEDQDVRHLALAVLKNLMAKHSFDD   1121 - 1190
RYREPRKQAQIASLYMPLYGMLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDT   1191 - 1260
SFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEKSSEKTDNCEKIPRPLSLIGSTLRFDKLD   1261 - 1330
QAETRSLLMCFLHIMKTISYETLIAYWQRAPSPEVSDFFSILDVCLQNFRYLGKRNIIRKIAAAFKFVQS   1331 - 1400
TQNNGTLKGSNPSCQTSGLLSQWMHSTSSHEGHKQHRSQTLPIIRGKNALSNPKLLQMLDNTMTSNSNEI   1401 - 1470
DIVHHVDTEANIATEVCLTILDLLSLFTQTHQRQLQQCDCQNSLMKRVFDTYMLFFQVNQSATALKHVFA   1471 - 1540
SLRLFVCKFPSAFFQGPADLCGSFCYEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQL   1541 - 1610
IKAVSQLIADAGIGGSRFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEM   1611 - 1680
LVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYWKVEKICTASL   1681 - 1750
LSEDTHPCDSNSLLTTPSGGSMFSMGWPAFLSITPNIKEEGAMKEDSGMQDTPYNENILVEQLYMCVEFL   1751 - 1820
WKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEE   1821 - 1890
EEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKE   1891 - 1960
IEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIE   1961 - 2030
VAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEI   2031 - 2100
FRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISK   2101 - 2170
ATPALPTVSISSSAEV                                                         2171 - 2186
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
21514340 2011 Human and mouse DOCK10 splicing isoforms with alternative first coding exon usage are differentially expressed in T and B lymphocytes.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18835169 2008 DOCK10-mediated Cdc42 activation is necessary for amoeboid invasion of melanoma cells.
18499258 2008 Dock10, a novel CZH protein selectively induced by interleukin-4 in human B lymphocytes.
More...