Property Summary

NCBI Gene PubMed Count 17
PubMed Score 7.15
PubTator Score 6.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
aldosterone-producing adenoma -1.817 7.5e-03
Astrocytoma, Pilocytic 1.900 2.7e-07
Chronic Lymphocytic Leukemia 1.022 3.6e-02
cutaneous lupus erythematosus 1.400 1.8e-02
cystic fibrosis 1.255 6.1e-04
Down syndrome 1.200 5.3e-04
ductal carcinoma in situ 1.200 2.3e-02
glioblastoma 1.100 1.4e-03
group 3 medulloblastoma -2.500 1.4e-04
interstitial cystitis 1.300 5.8e-03
invasive ductal carcinoma 1.132 5.5e-04
lung cancer -1.600 2.9e-02
medulloblastoma, large-cell -2.700 3.1e-05
osteosarcoma -1.120 4.3e-02
ovarian cancer -1.800 1.9e-06
Pick disease -1.300 1.9e-03
primary Sjogren syndrome 2.500 3.1e-05
progressive supranuclear palsy -1.800 1.2e-02
psoriasis -1.200 4.5e-03
subependymal giant cell astrocytoma 1.241 3.4e-02
ulcerative colitis 1.300 3.3e-03

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MAGERTRRFTRSLLRPGQAAELRHSAASAAAVAVSSRQQQRQEKPRLLEPLDYETVIEELEKTYRNDPLQ      1 - 70
DLLFFPSDDFSAATVSWDIRTLYSTVPEDAEHKAENLLVKEACKFYSSQWHVVNYKYEQYSGDIRQLPRA     71 - 140
EYKPEKLPSHSFEIDHEDADKDEDTTSHSSSKGGGGAGGTGVFKSGWLYKGNFNSTVNNTVTVRSFKKRY    141 - 210
FQLTQLPDNSYIMNFYKDEKISKEPKGCIFLDSCTGVVQNNRLRKYAFELKMNDLTYFVLAAETESDMDE    211 - 280
WIHTLNRILQISPEGPLQGRRSTELTDLGLDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKT    281 - 350
TRNMERLNLFSLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSNLQGCVTENENDPITNI    351 - 420
EPFFVSVALYDLRDSRKISADFHVDLNHAAVRQMLLGASVALENGNIDTITPRQSEEPHIKGLPEEWLKF    421 - 490
PKQAVFSVSNPHSEIVLVAKIEKVLMGNIASGAEPYIKNPDSNKYAQKILKSNRQFCSKLGKYRMPFAWA    491 - 560
VRSVFKDNQGNVDRDSRFSPLFRQESSKISTEDLVKLVSDYRRADRISKMQTIPGSLDIAVDNVPLEHPN    561 - 630
CVTSSFIPVKPFNMMAQTEPTVEVEEFVYDSTKYCRPYRVYKNQIYIYPKHLKYDSQKCFNKARNITVCI    631 - 700
EFKNSDEESAKPLKCIYGKPGGPLFTSAAYTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCD    701 - 770
INAKANAKKKEALETSVGYAWLPLMKHDQIASQEYNIPIATSLPPNYLSFQDSASGKHGGSDIKWVDGGK    771 - 840
PLFKVSTFVVSTVNTQDPHVNAFFQECQKREKDMSQSPTSNFIRSCKNLLNVEKIHAIMSFLPIILNQLF    841 - 910
KVLVQNEEDEITTTVTRVLTDIVAKCHEEQLDHSVQSYIKFVFKTRACKERTVHEELAKNVTGLLKSNDS    911 - 980
TTVKHVLKHSWFFFAIILKSMAQHLIDTNKIQLPRPQRFPESYQNELDNLVMVLSDHVIWKYKDALEETR    981 - 1050
RANHSVARFLKRCFTFMDRGYVFKMVNNYISMFSSGDLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANI   1051 - 1120
PDPLTPSESTQELHASDMPEYSVTNEFCRKHFLIGILLREVGFALQEDQDVRHLALAVLKNLMAKHSFDD   1121 - 1190
RYREPRKQAQIASLYMPLYGMLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDT   1191 - 1260
SFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEKSSEKTDNCEKIPRPLSLIGSTLRFDKLD   1261 - 1330
QAETRSLLMCFLHIMKTISYETLIAYWQRAPSPEVSDFFSILDVCLQNFRYLGKRNIIRKIAAAFKFVQS   1331 - 1400
TQNNGTLKGSNPSCQTSGLLSQWMHSTSSHEGHKQHRSQTLPIIRGKNALSNPKLLQMLDNTMTSNSNEI   1401 - 1470
DIVHHVDTEANIATEVCLTILDLLSLFTQTHQRQLQQCDCQNSLMKRVFDTYMLFFQVNQSATALKHVFA   1471 - 1540
SLRLFVCKFPSAFFQGPADLCGSFCYEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQL   1541 - 1610
IKAVSQLIADAGIGGSRFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEM   1611 - 1680
LVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYWKVEKICTASL   1681 - 1750
LSEDTHPCDSNSLLTTPSGGSMFSMGWPAFLSITPNIKEEGAMKEDSGMQDTPYNENILVEQLYMCVEFL   1751 - 1820
WKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEE   1821 - 1890
EEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKE   1891 - 1960
IEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIE   1961 - 2030
VAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEI   2031 - 2100
FRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISK   2101 - 2170
ATPALPTVSISSSAEV                                                         2171 - 2186
//

Text Mined References (22)

PMID Year Title