Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.49
PubTator Score 6.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.022 0.036
cutaneous lupus erythematosus 1.800 0.003
psoriasis -1.200 0.004
osteosarcoma -1.120 0.043
glioblastoma 1.100 0.001
group 4 medulloblastoma -3.000 0.000
cystic fibrosis 1.255 0.001
medulloblastoma, large-cell -2.700 0.000
lung cancer -2.600 0.000
interstitial cystitis 2.000 0.004
pilocytic astrocytoma 1.900 0.000
primary Sjogren syndrome 2.500 0.000
aldosterone-producing adenoma -1.817 0.007
subependymal giant cell astrocytoma 1.241 0.034
invasive ductal carcinoma 1.132 0.001
Pick disease -1.300 0.002
progressive supranuclear palsy -1.800 0.012
ductal carcinoma in situ 1.200 0.023
ulcerative colitis 1.300 0.003
ovarian cancer -1.800 0.000
Down syndrome 1.200 0.001

Gene RIF (4)

PMID Text
21514340 T cells and B cells exhibited inverse expression patterns of the DOCK10 isoforms
18854154 Knockdown of dedicator of cytokinesis 10 (DOCK10) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18835169 Silencing DOCK10 expression in melanoma promotes conversion to mesenchymal migration and is associated with decreased MLC2 phosphorylation and increased Rac1 activation.
18499258 Dock10 could represent a point of convergence for interleukin 4 signalling and small Rho GTPase function in B cells.

AA Sequence

MAGERTRRFTRSLLRPGQAAELRHSAASAAAVAVSSRQQQRQEKPRLLEPLDYETVIEELEKTYRNDPLQ      1 - 70
DLLFFPSDDFSAATVSWDIRTLYSTVPEDAEHKAENLLVKEACKFYSSQWHVVNYKYEQYSGDIRQLPRA     71 - 140
EYKPEKLPSHSFEIDHEDADKDEDTTSHSSSKGGGGAGGTGVFKSGWLYKGNFNSTVNNTVTVRSFKKRY    141 - 210
FQLTQLPDNSYIMNFYKDEKISKEPKGCIFLDSCTGVVQNNRLRKYAFELKMNDLTYFVLAAETESDMDE    211 - 280
WIHTLNRILQISPEGPLQGRRSTELTDLGLDSLDNSVTCECTPEETDSSENNLHADFAKYLTETEDTVKT    281 - 350
TRNMERLNLFSLDPDIDTLKLQKKDLLEPESVIKPFEEKAAKRIMIICKALNSNLQGCVTENENDPITNI    351 - 420
EPFFVSVALYDLRDSRKISADFHVDLNHAAVRQMLLGASVALENGNIDTITPRQSEEPHIKGLPEEWLKF    421 - 490
PKQAVFSVSNPHSEIVLVAKIEKVLMGNIASGAEPYIKNPDSNKYAQKILKSNRQFCSKLGKYRMPFAWA    491 - 560
VRSVFKDNQGNVDRDSRFSPLFRQESSKISTEDLVKLVSDYRRADRISKMQTIPGSLDIAVDNVPLEHPN    561 - 630
CVTSSFIPVKPFNMMAQTEPTVEVEEFVYDSTKYCRPYRVYKNQIYIYPKHLKYDSQKCFNKARNITVCI    631 - 700
EFKNSDEESAKPLKCIYGKPGGPLFTSAAYTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHVTCD    701 - 770
INAKANAKKKEALETSVGYAWLPLMKHDQIASQEYNIPIATSLPPNYLSFQDSASGKHGGSDIKWVDGGK    771 - 840
PLFKVSTFVVSTVNTQDPHVNAFFQECQKREKDMSQSPTSNFIRSCKNLLNVEKIHAIMSFLPIILNQLF    841 - 910
KVLVQNEEDEITTTVTRVLTDIVAKCHEEQLDHSVQSYIKFVFKTRACKERTVHEELAKNVTGLLKSNDS    911 - 980
TTVKHVLKHSWFFFAIILKSMAQHLIDTNKIQLPRPQRFPESYQNELDNLVMVLSDHVIWKYKDALEETR    981 - 1050
RANHSVARFLKRCFTFMDRGYVFKMVNNYISMFSSGDLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANI   1051 - 1120
PDPLTPSESTQELHASDMPEYSVTNEFCRKHFLIGILLREVGFALQEDQDVRHLALAVLKNLMAKHSFDD   1121 - 1190
RYREPRKQAQIASLYMPLYGMLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFQSQTAIKHANSVDT   1191 - 1260
SFSKDVLNSIAAFSSIAISTVNHADSRASLASLDSNPSTNEKSSEKTDNCEKIPRPLSLIGSTLRFDKLD   1261 - 1330
QAETRSLLMCFLHIMKTISYETLIAYWQRAPSPEVSDFFSILDVCLQNFRYLGKRNIIRKIAAAFKFVQS   1331 - 1400
TQNNGTLKGSNPSCQTSGLLSQWMHSTSSHEGHKQHRSQTLPIIRGKNALSNPKLLQMLDNTMTSNSNEI   1401 - 1470
DIVHHVDTEANIATEVCLTILDLLSLFTQTHQRQLQQCDCQNSLMKRVFDTYMLFFQVNQSATALKHVFA   1471 - 1540
SLRLFVCKFPSAFFQGPADLCGSFCYEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSHLQL   1541 - 1610
IKAVSQLIADAGIGGSRFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMATAQMKEHEKDPEM   1611 - 1680
LVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIAALIAEYLKRKGYWKVEKICTASL   1681 - 1750
LSEDTHPCDSNSLLTTPSGGSMFSMGWPAFLSITPNIKEEGAMKEDSGMQDTPYNENILVEQLYMCVEFL   1751 - 1820
WKSERYELIADVNKPIIAVFEKQRDFKKLSDLYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEE   1821 - 1890
EEGKEYIYKEPKLTGLSEISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKE   1891 - 1960
IEDRKTDFEMHHNINRFVFETPFTLSGKKHGGVAEQCKRRTILTTSHLFPYVKKRIQVISQSSTELNPIE   1961 - 2030
VAIDEMSKKVSELNQLCTMEEVDMIRLQLKLQGSVSVKVNAGPMAYARAFLEETNAKKYPDNQVKLLKEI   2031 - 2100
FRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTVMNEQITGRDDLSKRGVDQTCTRVISK   2101 - 2170
ATPALPTVSISSSAEV                                                         2171 - 2186
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
21514340 2011 Human and mouse DOCK10 splicing isoforms with alternative first coding exon usage are differentially expressed in T and B lymphocytes.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18835169 2008 DOCK10-mediated Cdc42 activation is necessary for amoeboid invasion of melanoma cells.
18499258 2008 Dock10, a novel CZH protein selectively induced by interleukin-4 in human B lymphocytes.
More...