Property Summary

NCBI Gene PubMed Count 25
Grant Count 5
R01 Count 1
Funding $176,869.66
PubMed Score 13.46
PubTator Score 90.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q96BY2 B2RDF6 Q9H833 Q9HAS1 MAP-1
Symbols MAP-1
PNMA4

Gene

PANTHER Protein Class (1)

Gene RIF (11)

PMID Text
27003254 PNMA2 functions as antagonist of MOAP-1 and PNMA1 through heterodimeric interaction
26269600 MOAP-1 is a tumor suppressor protein linked to the RASSF1A protein
25998847 miR-25 promotes cell proliferation and inhibits apoptosis in non-small cell lung cancer cells by negatively regulating MOAP1 expression.
25251443 Paraneoplastic Ma antigen-like 1 is suggested as a novel potential clinically useful prognostic biomarker for patients with pancreatic ductal adenocarcinoma.
23236846 PB1-F2 protein of influenza A virus interacts with human MOAP-1 protein.
22434376 Enforced miR-1228 expression can reduce MOAP1 expression and delay the progression of stress-induced cell apoptosis.
19100260 Data suggest that TRIM39 can promote apoptosis signalling through stabilization of MOAP-1.
18474619 The association of RASSF1A and MOAP-1 with death receptors involves an ordered recruitment to receptor complexes to promote cell death and inhibit tumor formation.
17535899 Inhibition of ubiquitin-mediated degradation of MOAP1 by apoptotic stimuli promotes BAX function in mitochondria.
16344548 RASSF1A is a tumor suppressor that activates Bax via MOAP-1
More...

AA Sequence

MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT      1 - 70
AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE     71 - 140
MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL    141 - 210
RGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV    211 - 280
QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF    281 - 350
T//

Text Mined References (27)

PMID Year Title
27003254 2016 PNMA2 mediates heterodimeric interactions and antagonizes chemo-sensitizing activities mediated by members of PNMA family.
26269600 2015 Modulator of apoptosis 1 (MOAP-1) is a tumor suppressor protein linked to the RASSF1A protein.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25998847 2015 miR-25 targets the modulator of apoptosis 1 gene in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25251443 2015 Paraneoplastic Ma Antigen-Like 1 as a Potential Prognostic Biomarker in Human Pancreatic Ductal Adenocarcinoma.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23236846 2012 [PB1-F2 protein of influenza A virus interacts with human MOAP-1 protein].
22529100 2012 The Trim39 ubiquitin ligase inhibits APC/CCdh1-mediated degradation of the Bax activator MOAP-1.
22434376 2012 miR-1228 prevents cellular apoptosis through targeting of MOAP1 protein.
More...