Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.46
PubTator Score 90.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
oligodendroglioma 2849 7.68170252906452E-17
posterior fossa group B ependymoma 1530 8.20138983272377E-13
atypical teratoid / rhabdoid tumor 4369 3.44310753351286E-10
pediatric high grade glioma 2712 1.04600808042681E-7
pilocytic astrocytoma 3086 1.67214954204662E-7
glioblastoma 5572 8.41800226782975E-7
malignant mesothelioma 3163 1.23382861140958E-6
medulloblastoma 1524 3.59554334391242E-6
medulloblastoma, large-cell 6234 7.58856546777946E-6
primitive neuroectodermal tumor 3031 3.23339766808702E-4
dermatomyositis 967 6.87793191142919E-4
astrocytic glioma 2241 0.00502385584521091
Multiple myeloma 1328 0.00806890301308335
subependymal giant cell astrocytoma 2287 0.0424237985970495
Disease Target Count Z-score Confidence
Endometriosis 535 0.0 1.0
Disease Target Count Z-score Confidence
Pigmented villonodular synovitis 9 3.723 1.9

Expression

  Differential Expression (14)

Synonym

Accession Q96BY2 B2RDF6 Q9H833 Q9HAS1 MAP-1
Symbols MAP-1
PNMA4

Gene

PANTHER Protein Class (1)

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG

Gene RIF (11)

PMID Text
27003254 PNMA2 functions as antagonist of MOAP-1 and PNMA1 through heterodimeric interaction
26269600 MOAP-1 is a tumor suppressor protein linked to the RASSF1A protein
25998847 miR-25 promotes cell proliferation and inhibits apoptosis in non-small cell lung cancer cells by negatively regulating MOAP1 expression.
25251443 Paraneoplastic Ma antigen-like 1 is suggested as a novel potential clinically useful prognostic biomarker for patients with pancreatic ductal adenocarcinoma.
23236846 PB1-F2 protein of influenza A virus interacts with human MOAP-1 protein.
22434376 Enforced miR-1228 expression can reduce MOAP1 expression and delay the progression of stress-induced cell apoptosis.
19100260 Data suggest that TRIM39 can promote apoptosis signalling through stabilization of MOAP-1.
18474619 The association of RASSF1A and MOAP-1 with death receptors involves an ordered recruitment to receptor complexes to promote cell death and inhibit tumor formation.
17535899 Inhibition of ubiquitin-mediated degradation of MOAP1 by apoptotic stimuli promotes BAX function in mitochondria.
16344548 RASSF1A is a tumor suppressor that activates Bax via MOAP-1
More...

AA Sequence

MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT      1 - 70
AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE     71 - 140
MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL    141 - 210
RGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV    211 - 280
QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF    281 - 350
T//

Text Mined References (27)

PMID Year Title
27003254 2016 PNMA2 mediates heterodimeric interactions and antagonizes chemo-sensitizing activities mediated by members of PNMA family.
26269600 2015 Modulator of apoptosis 1 (MOAP-1) is a tumor suppressor protein linked to the RASSF1A protein.
26201719 2015 Identification of novel target genes specifically activated by deregulated E2F in human normal fibroblasts.
25998847 2015 miR-25 targets the modulator of apoptosis 1 gene in lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25251443 2015 Paraneoplastic Ma Antigen-Like 1 as a Potential Prognostic Biomarker in Human Pancreatic Ductal Adenocarcinoma.
23472165 2013 Genome-wide association study link novel loci to endometriosis.
23236846 2012 [PB1-F2 protein of influenza A virus interacts with human MOAP-1 protein].
22529100 2012 The Trim39 ubiquitin ligase inhibits APC/CCdh1-mediated degradation of the Bax activator MOAP-1.
22434376 2012 miR-1228 prevents cellular apoptosis through targeting of MOAP1 protein.
More...