Property Summary

NCBI Gene PubMed Count 27
PubMed Score 13.10
PubTator Score 90.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.800 9.2e-06
astrocytic glioma -1.500 5.0e-03
Astrocytoma, Pilocytic -1.400 1.5e-07
atypical teratoid / rhabdoid tumor -2.400 3.4e-10
dermatomyositis 1.300 6.9e-04
ependymoma -1.800 1.4e-02
glioblastoma -1.500 1.0e-08
malignant mesothelioma -1.200 1.2e-06
medulloblastoma -1.300 3.6e-06
medulloblastoma, large-cell -1.900 7.6e-06
Multiple myeloma 1.303 8.1e-03
oligodendroglioma -1.400 7.7e-17
primitive neuroectodermal tumor -1.200 3.2e-04
subependymal giant cell astrocytoma -1.194 4.2e-02

Synonym

Accession Q96BY2 B2RDF6 Q9H833 Q9HAS1 MAP-1
Symbols MAP-1
PNMA4

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (13)

AA Sequence

MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEIEEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT      1 - 70
AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSRLNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE     71 - 140
MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL    141 - 210
RGPALDVIRVLKINNPLITVDECLQALEEVFGVTDNPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV    211 - 280
QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPEDGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF    281 - 350
T//

Text Mined References (29)

PMID Year Title