Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.21
PubTator Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.07305290538602E-5
osteosarcoma 7933 1.55548033664286E-4
ependymoma 2514 0.0062925829545727
spina bifida 1064 0.0499289782923534
Disease Target Count Z-score Confidence
Mantle cell lymphoma 20 3.005 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.100 0.006
osteosarcoma -2.702 0.000
spina bifida 1.010 0.050
ovarian cancer 1.300 0.000

Synonym

Accession Q96BX8 B3KTF1 O75249 Q8TF69
Symbols MOB1C
moblak
MOB-LAK
MOBKL2A

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

AA Sequence

MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFN      1 - 70
RVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNV     71 - 140
GTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKE    141 - 210
MTARMCH                                                                   211 - 217
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
More...