Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.33
PubTator Score 8.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.4e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.348 3.4e-06

Gene RIF (2)

AA Sequence

MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNW      1 - 70
SHYSFLKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKI     71 - 140
ISVNEDVTLRSALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIA    141 - 210
HFRELYGSILQENPQVVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVA    211 - 280
HDPDCGDVVRLGLSAIVRPSSIRQSTKGIFTAGKSFGNPCVTYLLTEWLPHSWLQCKALYLLGACEMLSF    281 - 350
DGHKLGYCSKVQTGITAAEPGGRTMSDHWQCCWKLYCPSEFSETLPVCRVFPSYCFIYQSYRCIGLQKQQ    351 - 420
HLCSPSSSPSLRQLLPSVLVGYFCCYCHFSKW                                          421 - 452
//

Text Mined References (15)

PMID Year Title