Property Summary

NCBI Gene PubMed Count 15
PubMed Score 942.06
PubTator Score 18.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Liver neoplasms 109
Melanoma 261
Disease Target Count P-value
osteosarcoma 7933 7.17681004204347E-7
interstitial cystitis 2299 1.15838908160595E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.83653143472153E-4
medulloblastoma 1524 3.61745217424926E-4
lung cancer 4473 4.82770606669931E-4
cystic fibrosis 1670 7.06711106822335E-4
primitive neuroectodermal tumor 3031 0.0016699029236159
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00198085696575212
astrocytic glioma 2241 0.00307162393005359
oligodendroglioma 2849 0.0035403277900213
ependymoma 2514 0.00562865617429592
nephrosclerosis 329 0.00564094282067352
pituitary cancer 1972 0.00745385600497833
atypical teratoid/rhabdoid tumor 1095 0.00890287545369915
glioblastoma 5572 0.0230877004675161
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0318699648702181
X-linked cerebral adrenoleukodystrophy 115 0.0441588743955
medulloblastoma, large-cell 6234 0.0497254442643059

Expression

Synonym

Accession Q96BW5 B0YJ77 B3KTF5 D3DRU0 Q9BY46
Symbols HPHRP
RPR-1

Gene

PANTHER Protein Class (1)

  Ortholog (15)

Gene RIF (5)

PMID Text
24750591 Our findings reveal that PTER may sense albuminuria in the progression of Membranous nephropathy induce tubular cell activation and lead to end-stage renal disease .
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19151714 In addition to FTO and MC4R, we detected significant association of obesity with three new risk loci in NPC1 (endosomal/lysosomal Niemann-Pick C1 gene), near MAF (encoding the transcription factor c-MAF) and near PTER (phosphotriesterase-related gene).

AA Sequence

MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKEN      1 - 70
LQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAM     71 - 140
SVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPF    141 - 210
QIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRR    211 - 280
VRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK     281 - 349
//

Text Mined References (17)

PMID Year Title
24750591 2014 Phosphotriesterase-related protein sensed albuminuria and conferred renal tubular cell activation in membranous nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
19151714 2009 Genome-wide association study for early-onset and morbid adult obesity identifies three new risk loci in European populations.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9925913 1998 Assignment1 of phosphotriesterase-related gene (PTER) to human chromosome band 10p12 by in situ hybridization.
9237666 1997 Molecular cloning and expression pattern of rpr-1, a resiniferatoxin-binding, phosphotriesterase-related protein, expressed in rat kidney tubules.