Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $290,468.75
PubMed Score 942.06
PubTator Score 18.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (59)

Disease Z-score Confidence
Intellectual disability 573 5.577 2.8
Wolf-Hirschhorn syndrome 32 5.273 2.6
Cri-Du-Chat syndrome 16 4.897 2.4
Microcephaly 149 4.822 2.4
Congenital heart disease 63 4.757 2.4
Chromosome 18p deletion syndrome 5 4.593 2.3
3p- syndrome 20 4.308 2.2
Hypogonadism 70 4.285 2.1
Prader-Willi syndrome 45 4.108 2.1
Chromosome 18q deletion syndrome 9 4.099 2.0
Chromosome 16p13.3 duplication syndrome 1 4.041 2.0
DiGeorge syndrome 46 3.989 2.0
Cancer 2,346 3.985 2.0
Disseminated intravascular coagulation 32 3.974 2.0
Patau syndrome 15 3.767 1.9
Ptosis 42 3.718 1.9
Chromosome Xp21 deletion syndrome 8 3.595 1.8
Hypospadias 65 3.523 1.8
Holoprosencephaly 52 3.51 1.8
Angelman syndrome 38 3.446 1.7
Edwards syndrome 15 3.442 1.7
Synostosis 18 3.428 1.7
Villonodular synovitis 1 3.365 1.7
Hydronephrosis 19 3.308 1.7
Cleft Lip 91 3.285 1.6
Incontinentia pigmenti achromians 6 3.282 1.6
Beckwith-Wiedemann syndrome 46 3.168 1.6
Cleft palate 125 3.165 1.6
Aniridia 26 3.161 1.6
Umbilical hernia 18 3.142 1.6
Spinocerebellar ataxia type 16 2 3.123 1.6
Chromosome 1p36 deletion syndrome 24 3.112 1.6
X-linked ichthyosis 18 3.106 1.6
Amenorrhea 60 3.064 1.5
Glycerol kinase deficiency 10 3.063 1.5
Body dysmorphic disorder 10 3.06 1.5
Nodular tenosynovitis 2 3.051 1.5
Microphthalmia 78 3.044 1.5
Cryptorchidism 67 3.042 1.5
Liver neoplasms 109
Melanoma 261
X-linked cerebral adrenoleukodystrophy 115
astrocytic glioma 2,241
atypical teratoid/rhabdoid tumor 1,095
cystic fibrosis 1,665
ependymoma 2,514
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
nephrosclerosis 329
oligodendroglioma 2,849
osteosarcoma 7,933
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031

Expression

Synonym

Accession Q96BW5 B0YJ77 B3KTF5 D3DRU0 Q9BY46
Symbols HPHRP
RPR-1

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
24750591 Our findings reveal that PTER may sense albuminuria in the progression of Membranous nephropathy induce tubular cell activation and lead to end-stage renal disease .
20797317 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19151714 In addition to FTO and MC4R, we detected significant association of obesity with three new risk loci in NPC1 (endosomal/lysosomal Niemann-Pick C1 gene), near MAF (encoding the transcription factor c-MAF) and near PTER (phosphotriesterase-related gene).

AA Sequence

MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKEN      1 - 70
LQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAM     71 - 140
SVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPF    141 - 210
QIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRR    211 - 280
VRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK     281 - 349
//

Text Mined References (17)

PMID Year Title
24750591 2014 Phosphotriesterase-related protein sensed albuminuria and conferred renal tubular cell activation in membranous nephropathy.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21492153 2011 Analysis of proteomic changes induced upon cellular differentiation of the human intestinal cell line Caco-2.
21269460 2011 Initial characterization of the human central proteome.
20797317 2010 Analysis of copy number variation in 8,842 Korean individuals reveals 39 genes associated with hepatic biomarkers AST and ALT.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
19151714 2009 Genome-wide association study for early-onset and morbid adult obesity identifies three new risk loci in European populations.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...