Property Summary

NCBI Gene PubMed Count 15
PubMed Score 948.72
PubTator Score 18.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Liver neoplasms 130 0.0 0.0
Melanoma 711 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Intellectual disability 1016 5.538 2.8
Wolf-Hirschhorn syndrome 32 5.313 2.7
Cri-Du-Chat syndrome 16 4.931 2.5
Microcephaly 166 4.812 2.4
Congenital heart disease 93 4.736 2.4
Chromosome 18p deletion syndrome 5 4.622 2.3
3p- syndrome 21 4.337 2.2
Hypogonadism 173 4.139 2.1
Prader-Willi syndrome 48 4.105 2.1
Chromosome 16p13.3 duplication syndrome 1 4.07 2.0
Chromosome 18q deletion syndrome 10 4.052 2.0
DiGeorge syndrome 47 3.994 2.0
Cancer 2499 3.989 2.0
Disseminated intravascular coagulation 38 3.977 2.0
Chromosome 9p deletion syndrome 13 3.848 1.9
Patau syndrome 14 3.777 1.9
Ptosis 48 3.698 1.8
Imperforate anus 25 3.632 1.8
Chromosome Xp21 deletion syndrome 8 3.598 1.8
Holoprosencephaly 56 3.535 1.8
Hypospadias 53 3.533 1.8
Edwards syndrome 17 3.465 1.7
Angelman syndrome 34 3.459 1.7
Synostosis 15 3.429 1.7
Cleft Palate 271 3.415 1.7
Villonodular synovitis 1 3.394 1.7
Hydronephrosis 89 3.298 1.6
Cleft Lip 141 3.278 1.6
Incontinentia pigmenti achromians 5 3.269 1.6
Potocki-Luspski syndrome 5 3.263 1.6
Beckwith-Wiedemann syndrome 44 3.182 1.6
Polydactyly 107 3.178 1.6
Umbilical hernia 93 3.178 1.6
Aniridia 25 3.173 1.6
Chromosome 1p36 deletion syndrome 23 3.168 1.6
Spinocerebellar ataxia type 16 2 3.153 1.6
X-linked ichthyosis 18 3.135 1.6
Nodular tenosynovitis 2 3.081 1.5
Amenorrhea 58 3.076 1.5
Glycerol kinase deficiency 10 3.076 1.5
Body dysmorphic disorder 11 3.066 1.5
Microphthalmia 76 3.061 1.5
Cryptorchidism 296 3.043 1.5
Trichorhinophalangeal syndrome type II 15 3.0 1.5

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -2.500 1.1e-02
atypical teratoid/rhabdoid tumor 1.400 8.9e-03
cystic fibrosis 1.104 7.1e-04
ependymoma -2.800 1.5e-02
glioblastoma -1.100 2.3e-02
interstitial cystitis -1.100 8.4e-04
intraductal papillary-mucinous adenoma (... 1.600 5.5e-04
intraductal papillary-mucinous carcinoma... 1.500 2.8e-03
intraductal papillary-mucinous neoplasm ... 1.100 3.2e-02
lung cancer -1.200 1.1e-02
medulloblastoma -1.700 3.6e-04
medulloblastoma, large-cell -1.200 5.0e-02
nephrosclerosis -1.156 5.6e-03
oligodendroglioma -2.700 9.6e-03
osteosarcoma 2.735 7.2e-07
pituitary cancer -1.200 7.5e-03
primitive neuroectodermal tumor -1.600 1.7e-03
X-linked cerebral adrenoleukodystrophy 1.900 4.4e-02

Synonym

Accession Q96BW5 B0YJ77 B3KTF5 D3DRU0 Q9BY46
Symbols HPHRP
RPR-1

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MSSLSGKVQTVLGLVEPSKLGRTLTHEHLAMTFDCCYCPPPPCQEAISKEPIVMKNLYWIQKNAYSHKEN      1 - 70
LQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKRLAEETGVHIISGAGFYVDATHSSETRAM     71 - 140
SVEQLTDVLMNEILHGADGTSIKCGIIGEIGCSWPLTESERKVLQATAHAQAQLGCPVIIHPGRSSRAPF    141 - 210
QIIRILQEAGADISKTVMSHLDRTILDKKELLEFAQLGCYLEYDLFGTELLHYQLGPDIDMPDDNKRIRR    211 - 280
VRLLVEEGCEDRILVAHDIHTKTRLMKYGGHGYSHILTNVVPKMLLRGITENVLDKILIENPKQWLTFK     281 - 349
//

Text Mined References (17)

PMID Year Title