Property Summary

NCBI Gene PubMed Count 10
Grant Count 45
R01 Count 20
Funding $6,044,926.43
PubMed Score 159.90
PubTator Score 35.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.400 0.027
acute myeloid leukemia -1.800 0.048
ovarian cancer -1.500 0.000

Gene RIF (2)

PMID Text
18626508 the efficacy of 5-FU-based chemotherapy in prostate cancers can be significantly improved by targeted expression of the suicide gene UPRT under the control of prostate-specific membrane antigen promoter/enhancer
17384901 isolation, expression, purification, and characterization of human uracil phosphoribosyltransferase

AA Sequence

MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACG      1 - 70
GSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA     71 - 140
DRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQ    141 - 210
SDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSII    211 - 280
QEFPEITILTTEVHPVAPTHFGQKYFGTD                                             281 - 309
//

Text Mined References (11)

PMID Year Title
26271729 2015 UPRT, a suicide-gene therapy candidate in higher eukaryotes, is required for Drosophila larval growth and normal adult lifespan.
25416956 2014 A proteome-scale map of the human interactome network.
18626508 2009 Specific targeting of prostate cancer cells in vitro by the suicide gene/prodrug system, uracil phosphoribosyltransferase/5-fluorouracil, under the control of prostate-specific membrane antigen promoter/enhancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17384901 2007 Identification and characterization of human uracil phosphoribosyltransferase (UPRTase).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...