Property Summary

NCBI Gene PubMed Count 10
PubMed Score 159.53
PubTator Score 35.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 4.5e-06
medulloblastoma, large-cell 6241 2.7e-02
acute myeloid leukemia 783 4.8e-02
Disease Target Count Z-score Confidence
Cancer 2499 3.48 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -1.800 4.8e-02
medulloblastoma, large-cell -1.400 2.7e-02
ovarian cancer -1.500 4.5e-06

Gene RIF (2)

AA Sequence

MATELQCPDSMPCHNQQVNSASTPSPEQLRPGDLILDHAGGNRASRAKVILLTGYAHSSLPAELDSGACG      1 - 70
GSSLNSEGNSGSGDSSSYDAPAGNSFLEDCELSRQIGAQLKLLPMNDQIRELQTIIRDKTASRGDFMFSA     71 - 140
DRLIRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFEKGNCGVSIMRSGEAMEQGLRDCCRSIRIGKILIQ    141 - 210
SDEETQRAKVYYAKFPPDIYRRKVLLMYPILSTGNTVIEAVKVLIEHGVQPSVIILLSLFSTPHGAKSII    211 - 280
QEFPEITILTTEVHPVAPTHFGQKYFGTD                                             281 - 309
//

Text Mined References (11)

PMID Year Title